KEGG   Phytophthora sojae: PHYSODRAFT_334881Help
Entry
PHYSODRAFT_334881 CDS       T03459                                 

Definition
(RefSeq) hypothetical protein
  KO
K01225  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
psoj  Phytophthora sojae
Pathway
psoj00500  Starch and sucrose metabolism
psoj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psoj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PHYSODRAFT_334881
Enzymes [BR:psoj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     PHYSODRAFT_334881
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_7
Motif
Other DBs
NCBI-GeneID: 20646892
NCBI-ProteinID: XP_009530495
JGI: Physo3_334881
UniProt: G4ZSY1
Position
Unknown
AA seq 512 aa AA seqDB search
MGTEVSMESSTTPATHVARADSPHLSDPEWEALQRLSTVIGDAAVATMLRTLTPTEQDGV
ALGFIMREQRDAASSTTVSSGTTIAQAQFGTNIPEKHPALASQVCTKVTNVLAQVDHMDS
DVVECVTEESSVVIDANWRKMANGEWNSTTCSTPKECAKICGLEGADYAGKHSITTSGQT
LNMKLETPGGVGTHVYMLEPSGKKYKQFQLLNQEFTFDVDMSSLPCGSNDALYFSKMDAD
GGTSRFPINTAGAAYGTGYCDAQCMKDVKFINGEANMEKAYGACCTEMDIWEANSMATSY
TTHPCSIDGQQRCSADEDCGATEANRYSGWCDKPGCGLNPFRMGNKKLYGRGKEFDIDTT
RAFTVVTQFITEDNTETGELVEIRRLYKQGARVVANPGSTWPALNGTDSITETMCKSSKA
FFGDHPYAVGGLAQMGKQMIGGMTLAMSIWVDYGSNMAWLDSYKTGQDPSVPGALRGDCP
NPGGDPESVFAESPDATVKFMNIRSGDFRSAY
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgggtacggaggtgtccatggaaagctccactacgcctgcaactcacgttgcacgcgct
gacagtccccacctgtcggacccagagtgggaagctctccaacgactgtcaacagtcatt
ggtgatgcggctgtagctacgatgctgcgtacgctaacgccgacagagcaagatggtgtt
gctctgggattcatcatgagggagcagcgagatgctgcttcgtctaccacggtgtcgtcc
gggacgacaatcgctcaagctcagtttggaactaacatcccggagaagcacccagcccta
gcctcgcaagtttgtaccaaagtgaccaacgtgctcgcccaggtcgaccacatggactcg
gacgttgtcgagtgcgtgaccgaggagtcgtcggtagtgatcgacgccaactggcgcaag
atggcgaacggcgagtggaactcgacgacgtgctcgacgccgaaggaatgcgccaagatc
tgcggactcgaaggcgcggactacgccggcaagcacagcatcaccacttccggtcaaact
ctcaacatgaagctggaaactcccggcggtgtgggcacccacgtctacatgctggaacca
tcggggaagaagtacaagcagttccagctgctgaaccaggagttcacctttgacgtcgat
atgtcctcgctgccctgtggctccaacgacgctctgtacttctccaagatggacgcagac
ggaggaacctcccgcttcccgatcaacactgcgggcgctgcttacggcacgggttactgt
gatgctcagtgcatgaaggacgtcaagtttatcaatggtgaggccaatatggaaaaggcg
tacggagcctgctgcactgaaatggacatttgggaggccaacagcatggccacgtcgtac
acgacccacccgtgctcgatcgacggccagcagcgatgctcagcggacgaggactgcggc
gctactgaggcaaatcgatactcgggatggtgcgataagcctggttgtggcctcaatccg
ttccggatgggcaacaagaagctctacggtcgcggaaaggagttcgatatcgacaccact
cgcgcattcacggtggtgacgcagttcatcacggaggacaatacggagactggagagttg
gtggagattcgtcgtctctacaagcaaggcgcccgtgtggtagccaacccgggcagtacc
tggccggcactgaacgggaccgattcgatcaccgagacgatgtgcaagtcgtcgaaggcg
ttcttcggagaccacccgtacgctgtgggcggccttgctcaaatgggcaagcaaatgatt
ggcggcatgacgctggcgatgagcatctgggtcgactacggctccaatatggcgtggctc
gacagctacaagaccggacaggacccgtccgttcccggtgcgttgcgcggtgactgtccg
aaccctggtggtgaccccgagagcgtcttcgcagagagccccgacgcgactgtgaagttc
atgaacatccgctcgggcgattttcggtcggcatactag

DBGET integrated database retrieval system