KEGG   Phytophthora sojae: PHYSODRAFT_467506Help
Entry
PHYSODRAFT_467506 CDS       T03459                                 

Definition
(RefSeq) hypothetical protein
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
psoj  Phytophthora sojae
Brite
KEGG Orthology (KO) [BR:psoj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:psoj01009]
    PHYSODRAFT_467506
Enzymes [BR:psoj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     PHYSODRAFT_467506
    3.1.3.48  protein-tyrosine-phosphatase
     PHYSODRAFT_467506
Protein phosphatases and associated proteins [BR:psoj01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    PHYSODRAFT_467506
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Gelsolin Y_phosphatase CDKN3 Init_tRNA_PT
Motif
Other DBs
NCBI-GeneID: 20653571
NCBI-ProteinID: XP_009514050
JGI: Physo3_467506
UniProt: G4YP66
Position
Unknown
AA seq 545 aa AA seqDB search
MGNGQSRDGFADVLPSGSAAKVSGTTKSDAPSISEAWTAGSRSSTAGEDGAEHVAKAPPL
VGKIVPPGHALQLEENTTSRLSLEAQEVVRAFNVPQRIEEDRFVIPESVRKSRTLDAYAD
VCSEILPGFLYVSNLQVARDTNKLRALGITHVINCCGELKHYEDGVDQPASSPSDSEVHL
LKLLLRDDANEDLTPFLPQVMEFIAACRQRESSHGEDSAKGQKVLVHCHQGVSRSCAFAI
AYVMLEQRLSYHEAAALVKRQRAISSPNAAFICQLLEWEKDLQVMKSQGNCSTAFVLNGL
YRLTPHSSYDSESFVLKRCYDPSAGSARQRQNIATVRTPEDGQRLLWSRGTFVFQNPSSS
SQLTIWHGSKCEIQDAKAMAKKLVEEDAEGHKGTACDHFGYAAELQWGRDSIPKLPAMFL
PTNGDSRNPTSTDEDVPVAPQLFILEAVDEEEGQDEWELLTNYDSEDLTPDSAFLLCSIQ
PHGVAQGYLWLGASCSFTPESVANAAQKQLRNLQNPPTLSPTTSLAIERQNQESDAFWQL
FEAGY
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggggaacggccaatctcgcgacgggtttgcggatgtgttgccctccgggtcggcggcg
aaagtctctgggacgacgaagtctgacgcaccatcgatttccgaggcgtggactgctgga
tcgcgttcctcaactgcaggagaagatggtgcagaacatgttgctaaagctccaccgctt
gtcgggaaaatcgtccctcctggtcacgcgttgcaactggaagagaacacaacttctcgt
ctgagtctcgaagcgcaagaagttgtccgagctttcaacgtgccccaacggattgaagaa
gaccgatttgtgatacctgagagtgtgcggaagtcccggacgttggatgcatatgctgac
gtgtgctcggagattttaccgggattcctatacgtgagcaaccttcaggtggcacgggat
acaaacaaactacgcgcgttgggcatcacccacgtgatcaattgctgcggagagctgaag
cattacgaagatggagttgatcagcctgcaagttcccccagtgactcggaggttcacctt
ttgaagctgttgctgcgagatgatgcaaacgaagacctgacgccgtttcttccccaagta
atggagttcatcgccgcctgcagacagagagagtcatcccatggggaggatagtgctaaa
ggacagaaggtgttggtgcactgtcatcagggagtttctcgctcttgtgcctttgcaatt
gcctacgtgatgctggagcagagactgtcgtaccacgaagctgcagccctggtgaagcgc
caacgagcgatctcgagtcctaacgcagcatttatctgccagcttctggagtgggagaag
gacctgcaggtgatgaaatcacaaggcaactgttcgactgcgttcgtactgaatggactc
taccgcttgacgccacattccagttacgactctgagtctttcgtgctcaagcgttgctat
gatccaagcgctggctcggctcggcagcgacaaaatatcgccactgttcgaacacctgaa
gacgggcagcgtctgctctggtctcgcggcacttttgtctttcaaaacccttcgagttct
agtcagttgactatttggcatggatcaaaatgcgagatccaggacgccaaggcgatggca
aagaaacttgtagaagaagacgctgagggccacaaaggaaccgcctgtgatcatttcggt
tatgccgctgagctccagtggggtcgggattcgatacctaaactgccagcaatgttcctg
ccgacgaatggggactctagaaatcccacaagtacagacgaagacgtgccagttgcaccg
cagttgtttatattggaagctgtcgacgaagaagagggccaagatgagtgggagctgtta
acgaattacgactcggaggaccttacaccagacagtgctttcctgctttgctctatccag
ccacacggagttgctcaaggttacttgtggcttggcgccagttgcagctttaccccagaa
tctgttgccaatgccgctcagaagcagcttcggaatctccaaaacccgccaactttatca
ccaacgacttcactagccattgagcgtcagaaccaggaaagcgatgcgttctggcagctc
tttgaagccggttactag

DBGET integrated database retrieval system