KEGG   Phytophthora sojae: PHYSODRAFT_472758Help
Entry
PHYSODRAFT_472758 CDS       T03459                                 

Definition
(RefSeq) hypothetical protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
psoj  Phytophthora sojae
Pathway
psoj00010  Glycolysis / Gluconeogenesis
psoj00562  Inositol phosphate metabolism
psoj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psoj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHYSODRAFT_472758
   00562 Inositol phosphate metabolism
    PHYSODRAFT_472758
Enzymes [BR:psoj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     PHYSODRAFT_472758
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     PHYSODRAFT_472758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 20654266
NCBI-ProteinID: XP_009517126
JGI: Physo3_472758
UniProt: G4YN56
Position
Unknown
AA seq 357 aa AA seqDB search
MFATKTKYWDQRSALSDQTPLRQDLELIQTQIVARHGVRYPTGGNIKETTAFLDKLKPFE
SSLPAWMRNYSLPYNLSVQGQLTHVGKRELRKLGARSLARSGFADEGADTLLRFFDVCPR
YQREVKKNPTAQTQQHEFQRSTTLVKTAQWLKQSLGLKDEDIKFSAKDLMAVQSACAFDI
AIYHHKHHWCSLMSMTFIHALDYLDDLEEFYWIGAGYKINYEMAAVLLREVFTTMGARAT
GDSALLGSFFFAHAETTLPLMTLMGYGDRSPLVANATEDDIASRGFRTSILSPFAANVEF
RLFKRKSSEEKEFYVQILINEKEAAIPGCGRVYCKLSELEQQWLYYLKVYDFHKDCM
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgttcgccaccaaaacgaaatactgggaccagcgcagtgctttgtcggaccagacgcca
ctacggcaggatttggagctcattcagactcaaatcgtagctcgtcatggcgtaagatac
ccaacgggaggtaatatcaaagaaactactgcgtttttggacaagttgaagcccttcgag
agttcgttgccggcgtggatgaggaactactcgctgccgtacaatctgagcgtgcaaggg
cagcttacgcatgttgggaagcgtgaactgcgtaagctgggggctcgtagcctcgccaga
agtggatttgctgatgaaggcgcagatactcttctgcgcttctttgacgtgtgtccccga
taccagcgagaggtgaagaagaacccaactgctcagacacaacaacatgagttccagaga
tcaaccaccctggtcaaaactgcgcaatggctgaagcagtcgcttggcttgaaggacgag
gacattaaattctcagccaaggatctgatggcagtgcaatctgcatgcgcgttcgacatt
gctatttatcatcacaagcaccactggtgctcgctcatgtcgatgactttcatccacgcg
ctggactacctggacgatctcgaggagttctactggattggggcggggtacaagatcaac
tacgagatggcagccgttctcctgcgcgaggtgttcactacgatgggagcaagagctacc
ggtgacagcgcgctcttggggagcttcttttttgcccatgcagagacgactctcccattg
atgactctgatggggtacggtgatcgctcgcctctcgtggcaaacgctacagaggacgac
atcgcatctcggggattccggacttcaatcctctctccattcgctgcaaacgtcgaattt
cggctgttcaagcgaaaatcgagcgaggaaaaggagttttatgtgcaaattctcatcaac
gagaaggaggcggcgatcccaggatgtggtcgtgtgtactgtaagctttcggagctagag
caacagtggctctactacctgaaggtgtatgatttccacaaggactgtatgtaa

DBGET integrated database retrieval system