KEGG   Phytophthora sojae: PHYSODRAFT_543375Help
Entry
PHYSODRAFT_543375 CDS       T03459                                 

Definition
(RefSeq) hypothetical protein
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
psoj  Phytophthora sojae
Pathway
psoj00071  Fatty acid degradation
psoj01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:psoj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PHYSODRAFT_543375
Enzymes [BR:psoj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     PHYSODRAFT_543375
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 20662499
NCBI-ProteinID: XP_009522422
JGI: Physo3_543375
UniProt: G4Z850
Position
Unknown
AA seq 644 aa AA seqDB search
MMQASTVARARAALALRRAFSSASGYVQDTIIPTYHFQKSLTRLPIPKLEDSLARYLAAV
EPVVTAQQLADTQRAVRDFQNGVGPELHRALVARDAENKHTSYINQWWLEMYLNDRQPLP
VNYNPQIKLKMDPVPAKNSQSQRAASLIASTVRVHRTLRDKKLEPDIFHTKPDTSKTTAF
QYFCKFLPESVSFYGAAALGAYPLDMSQYKNLFSSTRLPKIGQDELKVSPGSKHVVVQRG
TKFYTFDVLTADGGAVPDEQILANIEAILAEPLAKSTPDAPGMGLMTTMNRDAWANARQK
LEASGGVNKASLEQIDSALFVVSLEHESPATPEEVSRTFLVGDGTNHWFDKSFQLIVAAN
GTASVNFEHAWGDGVAVLRYLHELYGDSVKYPVLKASSQAKPKELTWDVNGETKQLLNEA
KKTYDKWTSSLLVACAESPVTRAVGKKYNIGTDGLMQMTIQLAHFKLHQKFVATYESAST
AAFKHGRTETVRSCTNEAVAFVRTMTDASASDSDKANALRAAVTKHSELTKNGVMGQGFD
RHLFALRAMAELQGIDTPEFYTLPAHQIMSKIILSTSTLSSPALEGGSFGPVNEDCYGIG
YGIEQEGSAFQLSSYRKDLPQLKELLVESIVELERLLADTTPKK
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaggcttccaccgttgcccgcgcacgcgcggcacttgccctgcgccgcgccttc
tcgtccgccagcggctacgtgcaggacaccatcatccccacctaccacttccagaagagc
ctgacgcgcctgccgatccccaagctcgaggactcgctggcgcgctacctggccgccgtg
gagcccgtggtgacggcgcagcagctcgcggacacgcagcgtgccgttagggacttccag
aacggcgtgggacccgagctgcaccgggcgctggtggcgcgcgacgccgagaacaagcac
acgtcgtacatcaaccagtggtggctcgagatgtacctgaacgaccggcagccgctgccc
gtcaactacaacccgcagatcaagctcaagatggaccccgtgcccgccaagaactcgcag
agccagcgcgcggcctcgctcatcgcctccaccgtgcgcgtgcaccgcacgctgcgcgac
aagaagctggagccggacatcttccacaccaagccggataccagcaagaccacggccttc
cagtacttctgtaagttcctgcccgagagtgtgagcttctacggagccgcggcgctcggc
gcgtacccgctggacatgtcccagtacaagaacctgttctccagcacgaggctgcccaag
atcggacaagatgagctcaaggtgtcgccgggatcgaagcacgttgtggttcagagagga
accaagttctatacctttgacgtgctcacggcggatggaggagctgtcccggacgagcag
atcctggccaatattgaagcgatcttggctgagccactggcgaagagcacgccggatgca
cctggaatggggctcatgacgaccatgaaccgtgacgcgtgggctaacgctcgccagaag
ctggaggccagtggaggcgtcaacaaggcgtcgctggagcagattgacagcgcgctgttc
gtggtgagcctggagcatgagtcccctgcgacgcctgaagaggtcagccgcacgttcttg
gtgggcgacggcactaaccactggttcgataagagctttcagctaatagtagccgcgaac
ggtacggcctcggtgaactttgagcacgcctggggagacggtgtggctgtgctgcgctac
ctccacgagttgtatggcgacagcgtcaagtacccggtgttgaaggcaagcagccaagct
aagcccaaggagctgacgtgggacgtcaacggtgagacgaagcagttgctgaacgaggcg
aagaagacgtacgacaagtggacttccagcttgttggtcgcgtgtgcggagagtcccgtg
actcgtgctgttggcaagaagtacaacattggcacggacgggctcatgcagatgacgatc
caactggcgcacttcaaactgcaccagaagtttgtggccacctacgagagcgccagcact
gccgcattcaagcacggacgtaccgaaaccgtgcgtagctgcacgaacgaagctgtggct
ttcgtgcgcaccatgaccgatgcctctgcgtcagactcggacaaggccaatgccctgcgt
gcggctgtgacgaagcacagcgagctgaccaagaacggtgtgatgggccagggctttgac
cgtcacctctttgcgttgcgagccatggctgaactgcagggaatcgacacgccggagttc
tacacgctgccggcccaccaaattatgagcaagattatcctgtcaaccagcacgctgtct
agcccagcgcttgagggcggtagctttggacctgtgaacgaggactgctacggcatcgga
tacggaatcgagcaagaaggttctgctttccagctctccagctaccgcaaggaccttcct
caactcaaggaactgctggtggaaagcattgtcgagctcgagcgcctgctggccgacacc
acccccaagaagtaa

DBGET integrated database retrieval system