KEGG   Phytophthora sojae: PHYSODRAFT_556434Help
Entry
PHYSODRAFT_556434 CDS       T03459                                 

Definition
(RefSeq) hypothetical protein
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
psoj  Phytophthora sojae
Pathway
psoj00071  Fatty acid degradation
psoj00410  beta-Alanine metabolism
psoj00592  alpha-Linolenic acid metabolism
psoj00640  Propanoate metabolism
psoj01040  Biosynthesis of unsaturated fatty acids
psoj01100  Metabolic pathways
psoj01110  Biosynthesis of secondary metabolites
psoj01212  Fatty acid metabolism
psoj04146  Peroxisome
Module
psoj_M00087  beta-Oxidation
psoj_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:psoj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    PHYSODRAFT_556434
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PHYSODRAFT_556434
   00592 alpha-Linolenic acid metabolism
    PHYSODRAFT_556434
   01040 Biosynthesis of unsaturated fatty acids
    PHYSODRAFT_556434
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PHYSODRAFT_556434
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    PHYSODRAFT_556434
Enzymes [BR:psoj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     PHYSODRAFT_556434
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 20663174
NCBI-ProteinID: XP_009519050
JGI: Physo3_556434
UniProt: G4YWP2
Position
Unknown
AA seq 676 aa AA seqDB search
MTSPLDAERRKSRVPARALAYVLHQSKSNVEKLEWLEQLLVQDPVFNHEKMNYLTRGEQY
KRATQMAGRAEIIAHRNKLSEEDTALLHVVLQGFTSCPSSTALHTGMFFKNLGLLFTDEQ
QARWMDMAKQWRMIGCYAQTELGHGSNVRGLETTATYIPATDEFEIHSPTLTSMKWWPGA
LARTANFGVVYARLLLGGKDYGVHNFMVQLRDLETHDAMPGVTLGDIGPKIGFNNVDNGY
CTFDHVRIPREQMGMRVATVTRDGKYVKNSGVPQEVLYFTMLQTRMSYIRSSGLALAKAC
TITIRYSAVRQQGYDANKPDSKEELSVLDYQTQQYRLFPLLAAAYAITLTGNQVDAFSLQ
LADQIKHGDLSMLLVGHAMSCGLKVLTSEMACGGIETCRRACGGHGYLLSSGLPVLLGDI
LQMVTAEGENFVICQQTARALLKVHGQFQSSGRLPAAMQFIANIGKPSRAQPRGKDQWLE
LDTYIDVFQQRFLYSLRGLVTKVASEPSVAAGIQNNSMHCYKLSNAYTYLVLVDNFVEAV
RSSSTLTKERLSNPEIVPVLQMLCRLFALTQLEATAGEFMEGGCVFPSEMPIIRANIEEL
LALIRPHAVTLVDGFNFSDHTLNSTLGRYDGNVYEALYESAQHDPLNHSSDKVALHELLR
PIRDEIARESGAKSRL
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgacgtccccgttggatgccgagcgccgcaagagtcgcgtgcctgcgagggcgctcgcg
tacgtgctgcaccagagcaagagcaacgtggagaagctcgagtggctggagcagttgctg
gttcaagaccctgtcttcaaccatgagaagatgaactacctaactcgcggcgagcagtac
aagcgcgccacgcagatggctggtcgcgcggagatcatcgcccaccgcaacaagctcagt
gaggaggacacagcgctattgcatgtggtccttcagggctttacgagttgtccgtcctcg
acggcactgcacaccgggatgttcttcaagaacctggggctgctcttcacggacgagcaa
caggcgcggtggatggacatggccaagcagtggcgcatgatcggatgctacgcccagacc
gagctcggccacggatccaacgtgcgcggactcgagaccaccgccacgtacatccccgcc
accgacgagttcgagatccactcgcccactctgacgtccatgaagtggtggccgggcgcg
ttggctcgcacggccaacttcggagtggtgtacgcgcgactgctgctcgggggcaaggac
tatggcgtgcacaacttcatggtgcagctgcgtgacttggagacgcacgacgcgatgccg
ggcgtgacgctgggcgacattggtccgaagatcggcttcaacaatgtggacaacgggtac
tgcacattcgaccacgtgcggattcctcgtgaacaaatgggcatgcgtgttgccactgtt
actcgtgacggcaagtacgtcaagaactcgggagttcctcaggaggtgctgtacttcacc
atgctgcagacccgcatgtcgtacattcggtcgagtggccttgcactggcgaaagcctgc
acgatcactattcgctactcggctgtgcgccaacaggggtacgacgccaacaaacccgac
tcgaaggaagagctgagtgtgctggactaccagacgcagcagtatcgtttgttcccgttg
cttgcggcggcgtatgccatcactctcaccggcaaccaagtggatgccttctcactgcag
ctcgctgatcagatcaagcacggtgacctgagcatgttgcttgtggggcacgcgatgagc
tgtggactcaaagtgctgacgtctgaaatggcgtgcggtggcattgagacttgccgtcgg
gcatgcggcggacacggttacctgctgtctagtggcctgcctgttctcctcggcgatatc
ctacaaatggtgaccgcagaaggcgaaaattttgtcatctgtcagcagactgctcgcgcg
ctgttgaaagtgcatggccaattccaatctagcggacgcctcccggcagcgatgcagttt
atcgcaaacatcggaaagccgtcgcgtgcgcagcctcggggcaaggaccaatggctcgag
ctcgacacgtacatcgacgttttccagcagcgcttcctgtactcgctccgtggtcttgtg
accaaggttgcatccgagccatccgtcgccgccggtatccagaacaactcgatgcactgc
tacaagctgtcgaacgcctacacgtatctcgtcttggtggacaacttcgtggaggccgtt
cgctcctcctcgactctgaccaaggaacgcttgtcgaacccggaaattgtgccggtgctt
cagatgctttgcaggcttttcgcgctcacgcaactggaagccaccgccggagagttcatg
gagggcgggtgcgtcttccccagcgagatgccgattatccgggccaacatcgaggagctg
ctcgcgctcatccgcccgcacgccgtgacgctggtggacggcttcaacttctcggaccac
acgctgaactcgacgctgggtcgctacgacgggaacgtgtacgaggctctgtacgagtct
gcgcagcacgacccgctgaaccactcgtcggacaaggtggcgttgcacgagttgctgcgc
ccgatccgcgacgaaattgcgcgagagtctggtgccaagtcgcgcctgtga

DBGET integrated database retrieval system