KEGG   Phytophthora sojae: PHYSODRAFT_558210Help
Entry
PHYSODRAFT_558210 CDS       T03459                                 

Definition
(RefSeq) hypothetical protein
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
psoj  Phytophthora sojae
Pathway
psoj00562  Inositol phosphate metabolism
psoj01100  Metabolic pathways
psoj04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:psoj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    PHYSODRAFT_558210
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    PHYSODRAFT_558210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:psoj01009]
    PHYSODRAFT_558210
Enzymes [BR:psoj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     PHYSODRAFT_558210
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     PHYSODRAFT_558210
Protein phosphatases and associated proteins [BR:psoj01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    PHYSODRAFT_558210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE DSPc Y_phosphatase 3-PAP GRAM Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 20663313
NCBI-ProteinID: XP_009525393
JGI: Physo3_558210
UniProt: G4ZAG1
Position
Unknown
AA seq 1124 aa AA seqDB search
MLRRHHCRRCGNVFCDACSSARMPLVNSGFFNPVRVCAKCSVAAKKAHARMVQERQKARS
FQPARRHSDTGDRGDSGRGGDVMEGGIMTSNGRRQVPGNLSRGASCESSSERERTGSEET
DHAGGHFGHGDGLLQTLPGEAVLVRNDNVRVRFLDRIEHTGILYVTNYRLVFSPAPDGGE
IDELPYASDLHSEALVAYQAVPLVTIDRVKRKEMVETDTGMLEIVGKDFRRLYFIFEGLV
SKQTFSQFDRTYALVRMHALGEPEGKVDEFAKFSLERFDGVNGAVDGWRVYDAVAEFQRM
GLSASTNRWRLSYINEQYELCPTYPSVLAVPSSVSDSVLAVASKFRSKGRIPVLSWRDRH
TGAVICRSSQPLVGLGQKQCDKDVFLIQAIAATNPSSTKLVIIDARPWKNAIAQKTVGRA
GYELTEHYEMRHGTASLKYADMVASEHNAAAAAAISAAELSINGDSLSVNDSSVASGWGD
SDERRQILETMEASLVLTECKLIFMGIENIHQMRKSYHKLMDLCTTKQNNDKWLDQLAST
HWMDHISRILDSAVEIVRIVKEQKSSVLIHCSDGWDRTAQLTALTELLIDPYYRTVQGFQ
VLIEKEWCSFGHKFRDRTGHGASNNSNEISPVFLQWIDCVWQVLVQSPSAFEFNERYLIL
ILDHLYSCRFGTFLYDSERERVEQEALHPTQSLWSFLSTMDRSVVLNPFYQPHNAPRMKW
KASVTATRQCFERKIGDEYVESPRSIPHMTHEDCDVHSLVDGFQDYKMSRCIFDSDGSSS
GCSSSTSMAFGSTVAVASSPAHSKDEATDAQVNAALESTHMQLSHELEHNGLKFGGDDLV
NWDCESDTEMAMLQPSCYHKIVRDLDAGFSFPQPLEASALSSFPSSPAVAPRSRSFYFGR
YAEDGGSVVKPSTPKSRSSLTSLFMPAVERAPLSDGLWNTSDTDAVSEGDEIGRYGALAS
CEDVIVPSCSMKSLRFWAHYYLRWDPTSHFDRDASVEIETVHLELLMRLEALTKRVDMAR
GDEGMKWERKTQHVLYDSPDRPGDVSSPSSVSPLKPCPRRERRATSEGSTSSQDSVLSAA
NDSKLAKQIAQLKEQRRRSLEEVEAKYQKQLAELLRANVAAGDA
NT seq 3375 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggcgccaccactgccggcgctgcgggaacgtcttctgcgacgcgtgctcctct
gcgcgcatgccattggtcaactcgggcttcttcaacccggtcagagtgtgcgccaagtgc
tcggtggcggccaagaaggcgcacgctagaatggtgcaggagcggcagaaggccaggagt
ttccagcctgccagacggcacagtgacacgggggatagaggagactcgggcagagggggc
gacgtgatggaggggggtatcatgacgtccaatggacgacgacaagtacccggtaattta
tccagaggcgcgtcgtgcgagagttccagcgagcgggagcggacgggcagtgaggagacg
gaccacgctggaggacactttgggcatggggacggactcctgcagactctaccgggtgag
gcagtgctggtgaggaacgacaacgtccgggtcaggttcctggacaggatagagcatacg
gggatactctacgtgacgaactaccgactggtgtttagccccgccccggacggtggggag
atagacgagttgccgtatgccagtgatctgcactcggaagctttggtggcgtaccaggcc
gtccccctcgtgacgatagatcgggttaagcgcaaggagatggtggagacggatacgggg
atgctggagattgtcgggaaggatttcaggcgactgtactttatctttgaagggctcgtg
tccaagcagacgttcagtcagttcgatcgaacgtacgcgcttgtaaggatgcacgcgctc
ggtgaaccggaagggaaagtggacgagtttgccaagttttcactggaaagatttgatggc
gttaacggtgcagtggatggttggagagtgtatgatgcagtggcggaattccagcgcatg
ggcttatcggcgtccacgaatcgatggcgactgagctacatcaacgagcagtacgaattg
tgtccaacctacccgtcagtgttggccgttccgtcttctgtatctgacagcgtgttggcg
gtggcgtccaagtttcgttctaaaggtcgaatccccgttctctcgtggcgtgaccgccat
acaggcgcggtgatctgtcgaagcagtcagccgctcgttggtctcggacagaagcagtgc
gacaaggacgtcttcctcatccaggccatcgcagcgaccaatccgtcgtcgacgaagctt
gtgattattgatgcgcggccctggaagaatgctatagcacaaaagactgtcggtcgtgcg
ggttacgaactcacggaacactatgaaatgcgtcatggaacagcgtcgttgaaatacgcg
gatatggtcgcatctgaacataatgcagcagcggctgcagccatatctgccgccgagctc
tctatcaatggcgattcactatcggtcaatgattccagtgttgcgagcggctggggcgat
agtgatgaacgcagacagattctggagacgatggaggcgtcgctggttttgaccgagtgc
aagttaattttcatgggcatcgagaatattcatcagatgcgcaaaagttaccacaaactc
atggatctatgcactacgaagcagaacaacgacaagtggctcgaccagttggcttcaact
cactggatggaccacatctctcgcatactggactcggccgtggaaatcgtccgcatcgtc
aaggaacagaagtccagcgttctgattcattgtagcgatgggtgggaccgtacagctcag
cttacagctcttacggaattgctgattgatccatactaccgaactgtgcaaggatttcag
gtgctgattgagaaagaatggtgcagctttggtcacaagttccgggatcgaacggggcat
ggcgcgagcaacaactctaacgaaatctcgccggttttcctgcagtggattgattgcgtg
tggcaagtgttagtccaatccccaagtgcgttcgagtttaacgagcgatacctcattctc
atcctggatcacctgtactcgtgccgcttcggcacgttcctgtacgactctgaacgggag
cgcgtcgagcaggaagccctccatccgacccaatctctgtggtcatttcttagcacaatg
gatcgttctgtggtactgaacccgttttatcaaccgcacaacgccccgcgcatgaagtgg
aaagcgagcgtgacggctacacgccagtgcttcgagaggaaaattggagatgaatacgtt
gaatctccccgatcaattcctcatatgacccatgaagactgcgacgtgcactcgctagtg
gacgggtttcaagactacaaaatgagtagatgcatatttgactcggatggatcctcttca
gggtgttcaagttccacctcgatggcgttcgggagtactgttgcagtggcgtcttcgcca
gcgcactcgaaggatgaagcgacggatgctcaggtgaatgcagccttggagtccacgcac
atgcagctgtcacatgaactggaacacaacggtttaaaatttggcggtgatgacttggtt
aattgggactgcgagagcgatacggagatggcgatgctacagccgtcgtgctaccacaaa
atcgttcgcgatctggatgcaggcttctcgttccctcaaccgctggaggcatcagcgctg
tcgagctttccctcgtccccagctgttgccccgcgctctcgctcgttctacttcggtcgc
tacgctgaagatggtgggagtgttgtaaagccgtcgacgccgaagtcccgttcatcgctg
acttcgctgttcatgcccgcggtagagcgagcgccgctgtcggacggtctgtggaatacg
tcagataccgacgctgtttcggagggtgatgagatcggtcgctatggggccctcgcctcg
tgtgaagatgtgatcgtgccgtcctgctcgatgaagtcgctcaggttctgggcgcactac
tatctgcggtgggatcccaccagccacttcgaccgagatgcaagcgtcgagattgagacg
gtacatctcgagttactcatgcggctagaagcgttgaccaagcgagtggatatggctcgg
ggtgacgaagggatgaagtgggagcgcaagacccagcacgtcttgtacgactccccggat
cgccctggtgatgtgagctcgcctagtagtgtgtcgcccctgaagccgtgtccaagacgc
gagcgcagggcgacctcagaaggaagcacgtcgtctcaggactcggttctaagtgcggca
aatgattcaaagcttgccaagcagatcgcgcagttgaaggagcagaggcgtcgaagtctc
gaggaagtggaagccaaataccagaagcagctcgccgaattactccgggccaacgtggca
gcaggcgatgcttaa

DBGET integrated database retrieval system