KEGG   Papaver somniferum (opium poppy): 113271429Help
Entry
113271429         CDS       T05758                                 

Definition
(RefSeq) calnexin homolog
  KO
K08054  calnexin
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom04141  Protein processing in endoplasmic reticulum
psom04145  Phagosome
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113271429
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    113271429
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:psom03110]
    113271429
   04131 Membrane trafficking [BR:psom04131]
    113271429
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:psom04091]
    113271429
Chaperones and folding catalysts [BR:psom03110]
 Other chaperones and cochaperones
  Calnexin / calreticulin
   113271429
Membrane trafficking [BR:psom04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    113271429
Lectins [BR:psom04091]
 Calnexin / calreticulin
  113271429
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Calreticulin
Motif
Other DBs
NCBI-GeneID: 113271429
NCBI-ProteinID: XP_026377074
Position
4
AA seq 551 aa AA seqDB search
MKRKEVENNKRLPFMVDFLLYLLLTTAVCLTSIPQYSIASADSVGSSPIFYDSFDQSFEG
HWIVSEENDYNGVWRHSKSEGHDDYGLLVSENARKYAIVKELDEPVSLNHGTIVLQFETR
FQNGLECGGAYLKYLRQQEVAGWNPKEFSNETPYSIMFGPDKCGSTNKVHFIFKHKNPVS
GEYIEHHLKSPPPAPSDKLSHVYTAILKPDNEVSILVDGEEKKKGNFLLADDFEPSLIPS
KSIPDPDDKKPLDWDERAKIPDPDATKPDDWDEDAPLEIEDEEAVKPEGWLDDEPKEIND
PDAAKPEDWDEEEDGEWEAPTIDNPLCEAAPGCGEWKKPMKRNPAYKGKWHPPLIDNPNF
KGIWKPQEIPNPHYFELDRPNFEPIAAIGIEIWTMQDGILFDNILIANDGKVAESYRMTT
WKPKYEAEKEKQKSEEELSGFQKVVFDLLYKIGDIPFLDAYKLQIVEFIDSGKKQPNVTI
GTLIPSAVVTLVICYKILFGGKKPNVATKEGRTDSAAAINQGRTGEKGEEPEREATAAAA
ARRRRANRRET
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaaaggaagtagagaataataaacgactgccatttatggtcgacttcctcctg
tacctactactgacaacagcagtttgtcttacaagtatcccacagtattccattgcatct
gctgattccgtcggctcttctccgatattttatgattcgttcgaccaatcttttgaggga
cattggatcgtctctgaggaaaatgactacaatggtgtatggaggcactcgaaaagcgaa
ggacatgatgattacgggcttcttgtgagcgaaaatgcaagaaagtatgccattgtgaaa
gagctggatgaacctgtcagtctgaaccacggaacaatcgttttgcagtttgagacacgt
ttccagaatggacttgaatgtggcggtgcatatttgaaatatctccggcagcaagaggtg
gcaggatggaaccccaaagaattcagtaacgagactccctactccatcatgtttggacct
gacaaatgtggttctacaaacaaggtgcatttcatcttcaagcataaaaaccccgtaagt
ggagaatatattgagcatcatctcaagtcacctcctcccgcaccttctgacaaactctca
catgtgtacactgcgatactgaaacctgacaatgaggtgagcattttggttgacggggaa
gagaagaaaaagggtaattttctcctggcagatgattttgagccatccctgattccgtcc
aagtcgattccagaccctgatgataagaagccattagactgggatgagagagcaaagata
ccagatcctgacgcgacaaaaccggatgactgggatgaggatgcgccactagaaatagaa
gatgaggaagctgtaaagcctgaaggctggttagatgacgagccgaaggaaatcaatgac
cctgatgcagctaagccagaagattgggatgaggaggaggatggtgaatgggaggcacct
acgattgataatccattgtgtgaagcagctcctggttgcggcgagtggaagaagccaatg
aagaggaatccagcttacaagggaaaatggcatcccccattgatcgacaacccgaatttt
aaaggcatttggaagccacaggagattccaaatcctcactactttgaacttgacagaccc
aactttgagccaatagctgccattggaatcgaaatttggacaatgcaagatggtatcttg
tttgataacatcttgatagcaaatgacgggaaggttgcagaatcatacaggatgacaaca
tggaagccaaagtacgaagctgagaaggaaaaacagaagtctgaggaagaactctcaggc
ttccagaaggtggttttcgatctgctatacaagattggagatattccattcttggatgct
tacaagctccagatagttgaattcattgatagcggaaagaagcaaccaaacgtcacaatt
ggaacccttatacccagtgctgtggttaccttggtgatatgctataagattctttttggt
gggaagaaaccaaatgtggccaccaaggaagggaggacagacagtgcagctgctattaat
cagggaagaactggagagaaaggtgaagagcctgagagggaagctactgctgctgctgct
gctcgtcgtcggagagctaatagacgggaaacctga

KEGG   Papaver somniferum (opium poppy): 113271480Help
Entry
113271480         CDS       T05758                                 

Definition
(RefSeq) calnexin homolog
  KO
K08054  calnexin
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom04141  Protein processing in endoplasmic reticulum
psom04145  Phagosome
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113271480
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    113271480
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:psom03110]
    113271480
   04131 Membrane trafficking [BR:psom04131]
    113271480
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:psom04091]
    113271480
Chaperones and folding catalysts [BR:psom03110]
 Other chaperones and cochaperones
  Calnexin / calreticulin
   113271480
Membrane trafficking [BR:psom04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    113271480
Lectins [BR:psom04091]
 Calnexin / calreticulin
  113271480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Calreticulin
Motif
Other DBs
NCBI-GeneID: 113271480
NCBI-ProteinID: XP_026377145
Position
4
AA seq 539 aa AA seqDB search
MDRMKCILVCLVACFFTLQLCVADPIFYESFDESFERRWIVSEKDDYEGVWKHAKSEGHD
DYGLLVSEKAKKYAIVKELDEAVSLKDGTIILQFETRLQNGLECGGAYLKYLRPQAAGWI
AKEFNNDSPYAIMFGPDKCGSTNKVHFILKHKNPKTGEYVEHHLKFPPSVPADKLSHVYT
AIIKPDNDLAILIDGEEKKTANFLKGDDFEPPLIPAKTIPDPDDKKPEDWDERAKIPDPA
AVKPDDWDEDAPMEIEDEEAEKPEGWLDDEPEEIDDPEASKPEDWDDEEDGEWEAPKTDN
PKCADAPGCGEWKKPMKSNPAYKGKWHAPLIENPNYKGIWKPQEIPNPDYFELEKPDFEP
VAAIGIEIWTMQDGILFDNILIAKDEKVAEEYRQKTWKPKFDVEKEKQKAEEAAAGDSDG
NLSDFQKKIFEVLYKFANLPFLADYKLKIYDIIEKGEKQPNITIGILVSVALVMLTIFYR
ILFGGKKTVAKATPEVRPAAGAANPVNNEGSSSGEKEGDKENESEDAAAPRRRATRREN
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggatagaatgaagtgtattctcgtgtgtttggttgcttgtttctttacattacagctt
tgtgttgctgatcctatattttacgagtcgtttgacgagtcgtttgagaggagatggatt
gtgtctgagaaagatgattatgaaggtgtttggaaacatgccaaaagtgagggacatgac
gattacggacttcttgtgagcgagaaagccaagaagtacgctattgtgaaagaactcgat
gaagcagtcagtctaaaggatggtactatcatcctgcagtttgagacccgtctacaaaat
ggactggagtgtggaggcgcttatctgaaataccttcgtcctcaagcagctgggtggatt
gcaaaggagttcaacaatgattctccctacgcaatcatgtttggacctgataaatgtggg
tcgacgaataaggtgcacttcatcttgaagcacaagaaccccaagactggggagtatgtt
gagcaccatctcaagttcccaccctccgttcctgctgacaaactatcccatgtctatact
gcaatcataaaacctgacaatgatttggccattcttatcgatggggaggaaaagaagaca
gctaatttccttaaaggggatgattttgagcctccacttatccctgccaagaccattcct
gatccagatgataagaaaccagaggactgggatgagagagccaaaattccagacccagct
gcagtaaagcctgatgattgggatgaggatgcacccatggagatcgaagatgaggaagct
gaaaagccagagggatggttggatgatgagcctgaggagattgatgatccagaagcatca
aagcccgaagattgggatgatgaagaggacggtgagtgggaagcacccaaaactgataac
ccaaagtgtgcagatgcacctggttgtggtgagtggaagaagccaatgaagagcaatcca
gcttacaaaggaaaatggcatgcaccactgattgaaaatccaaactacaagggcatctgg
aagccacaagaaattcctaaccctgactactttgagcttgagaaacctgattttgagcct
gttgccgccattggaattgagatctggaccatgcaagatggtatcttgtttgataacatt
ttgatagcaaaagatgagaaggttgcagaagagtacagacagaaaacatggaagccgaaa
ttcgatgttgagaaagaaaagcagaaggctgaggaagcagctgcaggtgattctgatggt
aatctctccgacttccagaaaaagatatttgaggtcctttacaagtttgcaaaccttcct
ttcttggctgattacaagctcaagatatatgatattattgagaagggtgagaaacagcca
aatatcaccattggtatccttgtttctgttgcattggttatgttgaccatcttctataga
attctttttggcggcaagaaaacagtggcaaaggcaaccccagaggttaggcctgctgct
ggagctgcaaatcctgtgaataacgaaggaagcagcagtggagagaaagaaggagacaag
gaaaatgaaagtgaagatgctgctgctcctcgcagaagggccacgagaagggagaactga

KEGG   Papaver somniferum (opium poppy): 113281257Help
Entry
113281257         CDS       T05758                                 

Definition
(RefSeq) calnexin homolog
  KO
K08054  calnexin
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom04141  Protein processing in endoplasmic reticulum
psom04145  Phagosome
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113281257
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    113281257
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:psom03110]
    113281257
   04131 Membrane trafficking [BR:psom04131]
    113281257
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:psom04091]
    113281257
Chaperones and folding catalysts [BR:psom03110]
 Other chaperones and cochaperones
  Calnexin / calreticulin
   113281257
Membrane trafficking [BR:psom04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    113281257
Lectins [BR:psom04091]
 Calnexin / calreticulin
  113281257
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Calreticulin
Motif
Other DBs
NCBI-GeneID: 113281257
NCBI-ProteinID: XP_026385732
Position
5
AA seq 539 aa AA seqDB search
MDRMKCILVCLVACFFTLQLCVADPIFYESFDESFEGRWIVSEKDDYEGVWKHAKSEGHD
DYGLLVSEKAKKYAIVKELDEAVSLKDGTIVLQFETRLQNGLECGGAYLKYLRPQAAGWI
AKEFNNDSPYAIMFGPDKCGSTNKVHFILKHKNPKTGEYVEHHLKFPPSVPVDKLSHVYT
AIIKPDNDLAILIDGEEKKTANFLKGDDFEPPLIPAKTIPDPDDKKPEDWDERAKIPDPA
AVKPDDWDEDAPMEIEDEEAEKPEGWLDDEPEEIDDPEASKPEDWDDEEDGEWEAPKTDN
PKCADAPGCGEWKKPMKSNPAYKGKWHAPLIENPNYKGIWKPQEIPNPDYFELEKPDFEP
VAAVGIEIWTMQDGILFDNILIATDEKVAEEYRQKTWKPKFDVEKEKQKAEEAAAGDSDG
NLSEFQKKIFEVLYKFANLPFLADYKLKIYNIIEKGEKQPNITIGIVVSVALVMLTIFYR
ILFGGKKAVAKATPEVRPAAGAAKPVNNEGSSSGEKEGDKENESEDAAAPRRRATRREN
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggatagaatgaagtgtattctcgtgtgtttggttgcttgtttctttacattacagctt
tgtgttgctgatcctatattttacgagtcgtttgacgagtcgtttgaggggagatggatt
gtgtctgagaaagatgattatgaaggtgtttggaaacatgccaaaagtgagggacatgac
gattacggacttcttgtgagcgagaaagctaagaagtacgctattgtgaaagaactcgat
gaagcagtcagtctaaaggatggtactatcgtcctgcagtttgagacccgtctacaaaat
ggactagagtgtggaggtgcttatctgaaataccttcgtcctcaagcagctgggtggatt
gcaaaggagttcaacaatgattctccctatgcaatcatgtttggacctgataaatgtggg
tcgacgaataaggtgcacttcatcttgaagcacaagaaccccaagactggggagtatgtt
gagcaccatctcaagttcccaccctccgttcctgttgacaaactatcccatgtctatact
gcaatcataaaacctgacaatgatttggctattcttatcgatggggaggaaaagaagacg
gctaatttccttaaaggggatgattttgagcctccacttatccctgccaagaccattcct
gatccagatgataagaaaccagaggactgggatgagagagccaaaattccagacccagct
gcagtaaagcctgatgattgggatgaggatgcacccatggagatcgaagatgaggaagct
gaaaagccagagggatggttggatgatgagcctgaggagattgatgatccagaagcatca
aagcctgaagattgggatgatgaagaggatggtgagtgggaagcacccaaaactgataac
ccaaagtgtgcagatgcacctggttgtggtgagtggaagaagccaatgaagagtaatcca
gcttacaaaggaaaatggcatgcaccactgattgaaaatccaaactacaagggcatctgg
aagccacaagaaattcctaaccctgactactttgagcttgagaaacctgattttgagcct
gttgctgccgttggaattgagatctggaccatgcaagatggtatcttgtttgataacatt
ttgatagcaacagatgagaaggttgcagaagagtacagacagaaaacatggaagccgaaa
ttcgatgttgagaaagaaaagcagaaggctgaggaagcagctgcaggtgattctgatggt
aatctctccgaattccagaaaaagatatttgaggtcctttacaagtttgcaaaccttcct
ttcttggctgattacaagctcaagatatataatattattgagaagggtgagaaacagcca
aatatcaccattggtatcgttgtttctgttgcattggttatgttgaccatcttctataga
attctttttggcggcaagaaagcagtggcaaaggcaaccccagaggttaggcctgctgct
ggagctgcaaaacctgtgaataacgaaggaagcagcagtggagagaaagaaggagacaag
gaaaatgaaagtgaagatgctgctgctcctcgcagaagggccaccagaagggagaactga

KEGG   Papaver somniferum (opium poppy): 113281298Help
Entry
113281298         CDS       T05758                                 

Definition
(RefSeq) calnexin homolog 2-like
  KO
K08054  calnexin
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom04141  Protein processing in endoplasmic reticulum
psom04145  Phagosome
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113281298
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    113281298
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:psom03110]
    113281298
   04131 Membrane trafficking [BR:psom04131]
    113281298
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:psom04091]
    113281298
Chaperones and folding catalysts [BR:psom03110]
 Other chaperones and cochaperones
  Calnexin / calreticulin
   113281298
Membrane trafficking [BR:psom04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    113281298
Lectins [BR:psom04091]
 Calnexin / calreticulin
  113281298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Calreticulin
Motif
Other DBs
NCBI-GeneID: 113281298
NCBI-ProteinID: XP_026385794
Position
5
AA seq 560 aa AA seqDB search
MHRFFHLQVDMKQKEVENNKLLPFMVDFLLFLLLTTAVCLTSIPQYSIASADSVDSSPIF
YDSFNQSFEGHWIVSEENDYNGVWRHSKSEGHDDYGLLVSEKARKYAIVKELDEPVSLND
GTIVLQFETRFQNGLECGGAYLKYLRQQEVAGWNPKEFSNETPYSIMFGPDKCGSTNKVH
FIFKHKNPISGEYIEHHLKSPPPAPSDKLSHVYTAILKPDNEVSILVDGEEKKKGNFLLA
DDFEPSLIPSKSIPDPDDKKPLDWDERAKIPDPDATKPDDWDEDAPLEIEDEEAVKPEGW
LDDEPKEINDPDAAKPEDWDEEEDGEWEAPTIDNPLCEEAPGCGEWKKPMKRNPAYKGKW
HPPLIDNPNFKGIWKPQEIPNPHYFELDRPNFEPIAAIGIEIWTMQDGILFDNILIENDE
KVAESYRMTTWKPKYEAEKEKQKSEEELSGFQKVVFDLLYKIGDIPFLDAYKLQIVEFID
SGKKQPNVTIGTLISSAVVTLVICYKILFGGKKPNVATKEGRTDSAAAINQGRTGEKGEE
PEREATAAAARRRRANRRET
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgcacaggttttttcatttgcaggttgatatgaaacaaaaggaagtagagaataataaa
ctactgccgtttatggtcgacttcctcctattcctactactgacaacagcagtttgtctc
acaagtattccacagtattccattgcatctgctgattccgtcgactcttctccgatattc
tatgattcgttcaaccaatcttttgagggacattggatcgtctctgaggaaaatgactat
aatggtgtatggaggcattcgaagagtgaaggacatgatgattacgggcttcttgtgagc
gaaaaggcaagaaagtatgccattgtgaaagagctggatgaacctgtcagtctgaacgac
ggaacaatcgttttgcagtttgagacacgtttccagaatggacttgaatgtggtggtgca
tatttgaaatatctccggcagcaagaggtggcaggatggaaccccaaagaattcagtaac
gagactccctactccatcatgtttggacctgacaaatgtggttctacaaacaaggtgcat
ttcatcttcaagcataaaaaccccataagtggagaatatattgagcatcatctcaagtcc
ccccctcccgcaccttctgacaaactctcacatgtgtacactgcgatactaaaacctgat
aatgaggtgagcattttggttgatggagaggagaagaaaaagggtaattttctcctggca
gatgatttcgagccatccctgattccatcaaagtcgattccagaccctgatgataagaag
ccattagactgggatgagagagcaaagataccagatcctgacgcgacaaaaccggatgac
tgggatgaggatgcgcccctagaaatagaagatgaggaagctgtaaagcctgaaggctgg
ttagatgacgagcctaaggaaatcaatgaccctgatgcagctaagccggaagattgggat
gaggaggaggatggtgaatgggaggcacctacgattgataatccattgtgtgaagaagct
cctggttgtggcgagtggaagaagccaatgaagaggaatccagcttacaagggaaaatgg
catcccccattgatcgacaacccgaattttaaaggcatttggaagccacaggagattcca
aatcctcactactttgaacttgacagaccaaactttgagccaatagctgccattggaatc
gaaatttggacaatgcaagatggtatcttgttcgacaacatcttgatagaaaatgacgag
aaggttgcagaatcatacaggatgacaacatggaagccaaagtacgaagctgagaaagaa
aaacagaagtctgaggaagaactctcaggcttccagaaggtggttttcgatcttctatac
aagattggagatattccattcttggatgcttacaagctccagatagttgaattcattgat
agcggaaagaagcaaccaaacgtcacaattggaacccttatatccagtgctgtggttacc
ttggtgatatgctataagattctttttggtgggaagaaaccaaatgtggccaccaaggaa
gggaggacagacagtgcagctgctattaatcagggaagaactggagagaagggtgaagag
cctgagagggaagctactgctgctgctgctcgtcgtcggagagctaatagacgggaaacc
tga

DBGET integrated database retrieval system