KEGG   Papaver somniferum (opium poppy): 113271641Help
Entry
113271641         CDS       T05758                                 

Definition
(RefSeq) protein OS-9 homolog
  KO
K10088  protein OS-9
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113271641
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:psom04091]
    113271641
Lectins [BR:psom04091]
 P-type lectins
  113271641
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRKCSH PRKCSH_1
Motif
Other DBs
NCBI-GeneID: 113271641
NCBI-ProteinID: XP_026377319
Position
4
AA seq 319 aa AA seqDB search
MTRLSWLVLLISLHFFNNVLADQIFTPQAGGTFGRSSREPKYSVEYHQADSPYQPNDDQE
SLMMSNEEGKKYMCFLPSVEKPKAESSVAQRNSSNSIVESERSMRLKTPDELLENLKGPC
FIRQEGWWTYEFCYHKKLRQIHLEGDKALQEFVLGEYDAEATALYNQNLSDFSTLKDPRS
KDASQRYHTHIYTNGTLCDLTNQPRETEVRFVCQPGPKGVITSIAELSTCKYALTFQTPY
LCKHPMFKQERPVQHTIYCNELPEVVGNEDQIPHREREDSVSSSPTNFKDNEKIKTVEGI
VAELSNYEEDVDSEQFAAT
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgacgaggttatcttggttggttctcctaatttcacttcatttcttcaacaatgttctg
gcggatcagatcttcacacctcaggcaggtgggacatttggtcgtagctctcgtgaacca
aaatacagcgttgaataccatcaagcagattccccctatcaacctaacgatgatcaggag
tcattgatgatgtcaaatgaggaggggaaaaagtacatgtgtttcttgcccagtgttgaa
aaaccgaaagctgaaagttcagttgctcagcgtaattcaagcaattcgattgttgaatca
gaaagaagtatgagattgaagacaccagatgaacttcttgagaatttgaagggtccctgc
tttattagacaagaaggctggtggacctatgagttctgctatcacaagaagctgcgccag
attcatttggagggagataaggcgcttcaggaatttgttttgggagaatatgatgctgaa
gccactgctctttacaaccagaatttatctgatttttctactttaaaagatccccgctca
aaagatgcatctcaaaggtatcacacacacatatacacgaatgggaccctctgtgatctc
acaaatcagcctcgagaaactgaggtgaggtttgtgtgccaaccagggcctaaaggtgtg
attacttctattgcggagctatccacttgcaagtatgcgcttacatttcaaaccccgtac
ctttgcaagcacccgatgttcaaacaagagagacccgtacagcacacaatctactgtaac
gagcttcctgaagttgtgggaaacgaagatcaaatccctcatagggaaagagaagatagc
gtcagtagcagccctactaactttaaagataatgaaaagataaaaacggttgaaggcatt
gtcgcagagctatctaattacgaggaagatgttgattcagaacagttcgcagcaacataa

KEGG   Papaver somniferum (opium poppy): 113281018Help
Entry
113281018         CDS       T05758                                 

Definition
(RefSeq) protein OS-9 homolog
  KO
K10088  protein OS-9
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113281018
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:psom04091]
    113281018
Lectins [BR:psom04091]
 P-type lectins
  113281018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRKCSH PRKCSH_1
Motif
Other DBs
NCBI-GeneID: 113281018
NCBI-ProteinID: XP_026385433
Position
5
AA seq 318 aa AA seqDB search
MTRVSWLVLLISLHFLNNVLADQIFTPQAGGTFGRSSREPKYSIEYLQADSPYQPNDDQE
SLVMSNEEGKKYMCFLPSVEKPKAESSVAQRNSSNSIVESERSVRLKTPDELFENLKGPC
FIRQEGWWTYEFCYHKKLRQIHLEGDKALQEFVLGEYDAEATALYNQNLSDFSTFKDPRS
KDASQRYHTHIYTNGTLCDLTNQPRETEVRFVCQPGPKGVITSIAELSTCKYALTFQTPY
LCKHPMFKQERPVQHTIYCNELPEVAGNEDQIPHREREDSISSSPTNFKDEKIKTVEGVV
AELPNYEEDVDSEQFAAT
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgacaagggtatcttggttggttctcctaatttcacttcatttcctcaacaatgttctg
gcggatcagatcttcacacctcaggcaggtgggacatttggtcgtagctctcgtgaacca
aaatacagcattgaataccttcaagcagattccccctaccaacctaacgatgatcaggag
tcattggtgatgtcaaatgaggaggggaaaaagtacatgtgtttcttgcccagtgttgaa
aaaccgaaagctgaaagttcagttgctcagcgtaattcaagcaattcgattgttgaatca
gaaagaagtgtgagattgaagacaccagatgaactttttgagaatttgaagggtccctgc
tttattagacaagaaggctggtggacttatgagttctgctatcacaagaagctgcgacag
attcatttggagggagataaggcgcttcaggaatttgttttgggagaatatgatgctgaa
gccactgctctttacaaccagaatttgtctgatttttctactttcaaagatccgcgctca
aaagatgcatctcaaaggtatcacacacacatatacacaaatgggaccctctgtgatctc
acaaatcagcctcgagaaactgaggtgaggtttgtgtgccaaccagggcctaaaggtgtg
attacttctattgcggagctatccacttgcaagtatgcgcttacatttcaaaccccttac
ctttgcaagcaccctatgttcaaacaagagagacccgtacagcacacaatttactgtaac
gagcttcctgaagttgcggggaacgaagatcaaatccctcatagggaaagagaagatagc
atcagtagcagccctactaactttaaagatgaaaagataaaaacggttgaaggcgtggtt
gcggagctacctaattatgaggaagatgttgattcagaacagttcgcagcaacataa

DBGET integrated database retrieval system