KEGG   Papaver somniferum (opium poppy): 113279575Help
Entry
113279575         CDS       T05758                                 

Definition
(RefSeq) thiamine thiazole synthase 2, chloroplastic-like
  KO
K03146  cysteine-dependent adenosine diphosphate thiazole synthase [EC:2.4.2.60]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00730  Thiamine metabolism
psom01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    113279575
Enzymes [BR:psom01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.60  cysteine-dependent adenosine diphosphate thiazole synthase
     113279575
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thi4 FAD_binding_2 DAO NAD_binding_8 Pyr_redox_2 FAD_oxidored GIDA Lycopene_cycl HI0933_like GMC_oxred_N NAD_binding_9 Pyr_redox_3 RNA_pol_Rpb1_3 FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 113279575
NCBI-ProteinID: XP_026384043
Position
5
AA seq 373 aa AA seqDB search
MANVLKNLRIFVDLATTLTSPLSKAPFLETQSSLFHGIQIPSRIKPIRSTSQNSKTSSSS
SSICMSSAAKTPPYDLTSFKFEPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLS
CAYEISKNPNVNVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHKLLDELEIEYDEQDTYV
VIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKDDKVAGVVTNWALVAMNHDTQSCM
DPNVMEAKVVILCGHDGPFGATGVKRLKSIGLIESVPGMKALDMNTAEDAIVKLTREIVP
GMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNVIDGNYADMGGIAPEL
ILAAAESAETAEA
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggccaatgtactaaaaaacctaagaattttcgtagacttggcaacaacccttacttca
ccactttccaaagcaccgttcttagaaacccaatcttcattattccatggcatccaaatc
ccatcaagaatcaaacccatcagatcaacttctcaaaacagcaaaacttcatcttcatca
tcatcaatctgtatgtcatcagcagcaaaaacaccaccatatgatcttacatcattcaag
ttcgaaccaatcaaagaatcaatcgtttctcgtgaaatgacccgtcgttacatgacagac
atgattacttacgccgatacagatgttgtcgttgttggtgccggttcagccggtttatca
tgtgcttatgaaatcagtaagaatccaaatgttaacgttgcaattattgaacagtcagtg
tctccaggtggtggtgcttggttaggcggacagcttttctcagccatggttgttcgtaaa
ccggctcacaaactcttggacgaactcgaaatcgaatacgatgaacaagacacttatgtt
gtcatcaaacacgctgcattgttcacttccaccatcatgtcaaagctgttggcgagacca
aacgtgaagctgttcaatgctgttgcagcagaggatttgatcgttaaagatgataaagtt
gcaggagttgttacaaactgggcattagtcgcgatgaaccatgatacgcagtcttgtatg
gatcctaatgtgatggaagctaaggttgttattttgtgcggtcatgatggtccatttggt
gctaccggtgttaaaaggttgaagagtatcggtttgattgaatctgttcctggaatgaaa
gctctcgacatgaacactgctgaagatgccattgttaagctcaccagagaaattgttcct
ggtatgattgttactggtatggaagttgctgaaattgatggtgccccaagaatgggacca
acatttggagctatgatgatatcagggcagaaggcagcacatttggcattgaaggcattg
ggacaacctaatgtgattgatggaaactatgctgatatgggaggtattgcaccagaactt
atccttgctgctgctgaatcagctgagactgctgaagcttaa

DBGET integrated database retrieval system