KEGG   Papaver somniferum (opium poppy): 113279784Help
Entry
113279784         CDS       T05758                                 

Definition
(RefSeq) serine decarboxylase 1-like
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00340  Histidine metabolism
psom01100  Metabolic pathways
psom01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    113279784
Enzymes [BR:psom01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     113279784
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Arena_RNA_pol
Motif
Other DBs
NCBI-GeneID: 113279784
NCBI-ProteinID: XP_026384235
Position
5
AA seq 471 aa AA seqDB search
MVGSVGVPGAKFEVSVPYDEFDWTSASLREDFAAVVLAENVTGKEIVDTIFPHAVTEPDE
DGENTSEREAYMANVLAIYESCMTERTKHHLGFPFNLDFDYGVLSRLQNFYINNCGDPFI
ESSYAVHSRKFEVGVLEWFARLWEIENHEYWGYITNGGTEGNFHGILLGREAFPNGILYA
SEDSHYSVFKAARMYRMKCVKVNTLISGEIDYADFKAKLLHNKNNPAVVNVNIGTTVKGG
VDNLDLVIETLKTIGFSEDRFYIHCDGALFGLMMPFVKHAPKISFKKPIGSISVSGHKFV
GCPMPCGVQITRLDHINALSRNVEYIGSRDATITGGRSGHAPIYLWYALNHKGYCGIQKE
VQLCLTNAQYLKDRLRAEGIGAMLNEFSNIVVFERPQNEDLIHKWQLACQGNIAHIVVMP
NVTIEKLDDFLNDLIQKRSTWSGKGKVQPICISIDVGKENCACQRHSCDGL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggttggaagtgttggggtgcctggagctaaatttgaagtatctgtaccgtatgacgaa
tttgattggacaagtgcatctttacgggaggattttgctgcagttgttttggctgaaaat
gtaacagggaaagaaatcgttgatacaatctttccccatgccgttactgagcctgacgag
gatggagaaaacacttcggaaagagaagcgtatatggctaatgtacttgctatatacgaa
agctgtatgactgaaaggaccaaacatcacttaggtttccctttcaatctggacttcgat
tatggtgttctttcgaggctgcaaaatttctacatcaacaactgtggtgatccctttatt
gagagcagctatgctgttcattccaggaagttcgaagtgggtgtgttagagtggtttgct
cgactctgggaaatagaaaatcatgaatattggggatacattacaaacggtggtacagaa
ggaaattttcacggtattcttttagggagggaagcttttcctaatggaattttatatgcc
tcagaagattcacattattctgtttttaaagcggcgcgaatgtacagaatgaagtgtgtc
aaagttaacactctgatctctggggaaatagattatgcagatttcaaagccaaactactg
cataacaagaacaacccagctgtagttaacgtcaatataggaaccactgttaaaggaggt
gttgacaatctcgatcttgtaatagaaacccttaaaacaattggtttctccgaagacagg
ttctacattcattgtgatggggctctatttggcttgatgatgccgtttgttaaacatgct
ccaaaaatctcatttaagaagccaattgggagtattagtgtttccggccacaagttcgtt
ggatgtccaatgccttgtggtgttcagataacaagattagatcacatcaatgctctctca
aggaatgttgagtacataggttcccgagatgccacaatcacgggtggtcgcagtggtcat
gcaccaatttacctctggtatgcactgaaccataaaggctattgtgggattcaaaaagaa
gtccaactttgcctcacgaatgcccagtatttgaaagaccgtctacgtgctgaagggata
ggtgccatgctgaatgaatttagcaatattgttgtctttgaaaggccacaaaatgaagat
cttattcacaagtggcaactcgcttgtcagggaaatattgctcatattgttgttatgcca
aatgtcaccatcgagaaattggatgatttcttaaacgatctgattcagaaacgttcgacg
tggtcagggaagggaaaggttcaacctatttgtatttccatcgatgttgggaaggaaaat
tgtgcttgtcagcgacacagctgtgatggtctctaa

DBGET integrated database retrieval system