KEGG   Papaver somniferum (opium poppy): 113281005Help
Entry
113281005         CDS       T05758                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase, chloroplastic-like
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00030  Pentose phosphate pathway
psom00480  Glutathione metabolism
psom01100  Metabolic pathways
psom01110  Biosynthesis of secondary metabolites
psom01200  Carbon metabolism
Module
psom_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
psom_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    113281005
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    113281005
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psom04147]
    113281005
Enzymes [BR:psom01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     113281005
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     113281005
Exosome [BR:psom04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   113281005
  Exosomal proteins of colorectal cancer cells
   113281005
  Exosomal proteins of bladder cancer cells
   113281005
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 113281005
NCBI-ProteinID: XP_026385419
Position
5
AA seq 599 aa AA seqDB search
MAALSSSTCYSSSSSSSLYSPSSSSSGNYVRSVSISSVSKRFLPKKISLSSPRYWNVVNM
QDGAVTAKTTPLLENVIPVKEEKAKVGGLSVEEEILNVVGSIPDENETVSITVVGASGDL
AKKKIFPALFALYYEDCLPKHFTVFGYARSKMTDEELRDMVSRTLTCRIDKRENCSEKME
QFLARCFYHSGQYDSENNFKELDKKLKEHEGARVSNRLFYLSIPPNIFINVVKSASCSAS
SSNGWTRVIVEKPFGRDSESSAALTRGLKEYLVEDQIFRIDHYLGKELVENLSVLRFSNL
IFEPLWSRQYIRNVQFIFSEDFGTEGRGGYFDSYGIIRDIMQNHLLQILALFAMETPVSL
DAEDIRNEKVKVLRSMRPLQLDNVVVGQYKSCTKGGINYPGYTDDETVPKNSITPTFAAA
ALFIDNARWDGVPFLMKAGKALHTRRAEIRVQFRHVPGNLYKKNFGMDLDRATNELVIRV
QPDEAIYLKINNKVPGLGMKLDRSNLNLHYAARYSKEIPDAYERLLLDAIEGERRLFIRS
DELDAAWALFTPLLKELEEKKIVPELYPYGSRGPVGAHYLSAKYNVRWGDISSADCQNE
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atggcagccctttcttcatcaacttgttattcatcttcgtcatcatcctcactctattct
ccttcttcttcttcatctgggaattatgtacgcagtgtatcaatttcttcagtatctaag
agattcttacctaagaagatctctttatcatcacctcgatattggaatgttgtcaacatg
caagatggtgcagtgactgctaaaacaacaccattacttgaaaatgtaattcctgtcaag
gaggaaaaagcgaaagtgggtggtttatcagtggaagaagaaatacttaatgttgttggt
tcaattcccgatgaaaatgagacagttagtatcactgtagttggagcttcaggtgacctt
gctaagaagaagatatttcctgcccttttcgcactttattacgaagattgtttacccaag
catttcactgtgttcggatatgctcggagtaagatgactgatgaggaactacgagacatg
gttagcaggactcttacttgcagaattgataaaagggagaactgtagtgaaaagatggag
cagttcttagcaagatgcttctaccattctggtcagtatgactcggagaacaatttcaag
gagctagacaagaagctgaaggagcatgagggtgcaagggtttcaaaccgtcttttctat
ctatcgatccctccaaatatatttataaatgttgtaaaatctgcaagctgctcagcatct
tcatctaatggctggactagggtcattgttgagaagcccttcggccgagactctgaatcc
tctgctgctttaacaagaggcttaaaggagtacttagtggaggatcaaattttcagaatt
gatcactatttggggaaggaactagtggaaaacctttctgttcttcgtttctccaatctt
atctttgaacctttatggtcaagacaatacataaggaatgttcaatttatcttctcagaa
gacttcggtactgaaggacgaggagggtacttcgacagttatggtattataagagacatt
atgcagaaccatctgcttcaaatattagcccttttcgccatggagactcctgtcagtttg
gatgctgaagacatcagaaatgaaaaggtaaaagttctacgctcaatgaggcctttgcaa
cttgacaacgtggtggttggacagtataagagttgcactaaggggggtattaactatcca
ggctacacagatgatgagacagtacctaaaaatagcataaccccgacatttgcagcggct
gcactctttatagataatgccagatgggatggagttccctttttaatgaaagctgggaaa
gccttacatactagaagagcagagatcagggtacagttcaggcatgttcctggtaatttg
tacaagaagaattttggaatggacctggaccgagcaacaaatgaacttgtcatcagagtg
cagcctgatgaagctatttacttgaaaatcaacaacaaagtccctggtttgggcatgaag
ttggaccgcagtaatctaaaccttcattatgcagcaagatactccaaggagattccagat
gcttacgagagactgttacttgatgcaattgaaggagaacgacgtttgttcatcaggagt
gacgaactggatgctgcatgggccctcttcacacctctgctgaaagagctagaggagaag
aagatagtccctgagttgtatccttatggtagtcgaggacctgttggcgctcattatctt
tcagctaagtataatgttcgatggggtgatatcagtagtgcagactgccagaatgagtga

DBGET integrated database retrieval system