KEGG   Papaver somniferum (opium poppy): 113281457Help
Entry
113281457         CDS       T05758                                 

Definition
(RefSeq) non-specific phospholipase C6-like
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00562  Inositol phosphate metabolism
psom00564  Glycerophospholipid metabolism
psom00565  Ether lipid metabolism
psom01100  Metabolic pathways
psom01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    113281457
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    113281457
   00565 Ether lipid metabolism
    113281457
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:psom02042]
    113281457
Enzymes [BR:psom01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     113281457
Bacterial toxins [BR:psom02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   113281457
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphoesterase DUF5338
Motif
Other DBs
NCBI-GeneID: 113281457
NCBI-ProteinID: XP_026385978
Position
5
AA seq 520 aa AA seqDB search
MERFKKPKSFSLYLFFTFLLVSHSYVFAAQQPIKTIVVLVLENRSFDHMLGWMKKSINPS
INGVTGRECNPISTKTTDTSTICFSNGAEYVDPDPGHSFEAVEHQVFGSSQIPTMTGFVE
QALTMPASNLSETVMKGFRPESVPVFASLVREFAVFDRWFSSIPGPTQPNRLFVYSATSY
GATSHVKSQLAKGFPQKTIFDSLHENGKDFGIYFQNIPNTLFYRNLRKLKYIFKFHQFEL
KFKKHARQGKLPSLTVIEPRYFDLKGIPANDDHPSHDVAHGQKLVKEVYEALRSSPQWNE
TLLVITYDEHGGFYDHVTTPYVNVPNPDGNIGPAPYFFKFDRLGVRVPTIMVSPWIKKGT
VISAPNGPTPDSEFEHSSIPATIKKMFNLSSNFLTNRDAWAGTFEEVVGELTSPRTDCPE
VLPDVAPLRSREANEDKELSGFQSEVVQLAAVLNGDHLLSSFPDEISNKMNVKEAHTYVN
EAVSRFIRASKEAIKLGAEESAVVDMRSSLTTRPTTTSHP
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggaaagattcaagaaacccaaatcattttctttgtacttgttcttcactttcctgttg
gtttctcattcctatgtttttgcagctcagcaacccataaaaactattgttgtacttgta
ctggagaatagatcttttgatcatatgttaggatggatgaagaaatccatcaacccatca
attaatggagtgacagggagagaatgtaatccaatttcgacgaaaaccaccgatacttcg
acgatatgtttcagtaatggtgcagaatatgtagacccagatcctggtcattcatttgaa
gctgttgagcatcaagtttttggttcaagtcaaatcccaacaatgactggttttgttgaa
caagcactaaccatgcctgcttctaatctgtcagaaacagtaatgaaagggttcagacca
gaatctgttccggtattcgcttcattggtacgtgaattcgcagtttttgatcgttggttc
tcatctattccaggaccaacacagcctaatagactgtttgtttactctgccacttcttat
ggtgcaacaagtcatgtgaagagtcagttagcaaaggggttcccacagaaaacaatcttt
gactctttacatgaaaatggaaaggattttggaatttattttcaaaacattccgaataca
ctgttttataggaatttgaggaaattgaagtacattttcaaatttcatcaatttgagttg
aaattcaagaagcatgcaagacaagggaaactgcctagtttaactgtgattgaaccaaga
tactttgatcttaaaggaatacctgcaaacgatgaccatccttctcatgatgttgcgcat
ggacaaaagcttgtgaaagaagtgtacgaggcattgagatcaagtcctcaatggaatgaa
actctgttggttatcacttatgatgaacatggtgggttctatgaccatgttactactcca
tatgtgaatgtccctaatccagatggaaatataggtcctgcgccttacttcttcaagttt
gatcggttaggagttcgtgtaccgacaatcatggtgtctccttggatcaaaaaaggaacc
gtgatcagtgcaccaaatgggccaacaccagactcagagtttgagcactcatccatacct
gccacaataaagaagatgttcaacctttcatccaacttcttgactaacagagatgcatgg
gctgggacattcgaggaggtcgttggagagctaacatcacctagaactgattgtccagag
gtacttccagatgtggctcctctgaggagcagagaagcaaatgaagataaagaattatct
gggtttcagagtgaggtagtacagctggcggctgttctcaacggcgaccacttattgagc
agcttcccagatgagataagcaacaagatgaacgtaaaggaagctcacacttatgtgaac
gaagctgtttcgagattcatcagagctagtaaagaggcaataaagttgggtgcagaggag
tctgctgttgtagacatgaggtcttctctcacaaccagacccaccaccacaagtcatccc
tga

DBGET integrated database retrieval system