KEGG   Papaver somniferum (opium poppy): 113281895Help
Entry
113281895         CDS       T05758                                 

Definition
(RefSeq) protein PHYLLO, chloroplastic-like isoform X1
  KO
K14759  isochorismate synthase / 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase / 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase / O-succinylbenzoate synthase [EC:5.4.4.2 2.2.1.9 4.2.99.20 4.2.1.113]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00130  Ubiquinone and other terpenoid-quinone biosynthesis
psom01100  Metabolic pathways
psom01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    113281895
Enzymes [BR:psom01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     113281895
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     113281895
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     113281895
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     113281895
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M_2 MR_MLE_C Abhydrolase_1 Abhydrolase_6 Hydrolase_4 BAAT_C TPP_enzyme_C Abhydrolase_2 Abhydrolase_3 Ndr DLH Thioesterase Esterase LIDHydrolase DUF1057 Cutinase PGAP1 Lipase_3 DUF676 TPP_enzyme_M DUF900
Motif
Other DBs
NCBI-GeneID: 113281895
NCBI-ProteinID: XP_026386583
Position
5
AA seq 1653 aa AA seqDB search
MEAGGDDDDEEEEDSELPVELSYTRTLPPALTFEHGIKKIKVEIDKLKLNSPSSRSGILR
FQVAVPPSTKAWNWLCNQPQTPEVFPQFYLSKMDVDKEGVDLHLPNGLLGVSGVSAAAQF
TCKTTDASKERSSIKRYLSVASPLIRAYGFVGIHFDTESYKMRRENGSSYYFIPQLELDE
YGSTSLLAATLAWDYSSPRSFNEAMRSLELSLDQVVSGLSISDEICQNKFVSSGLTQANL
VDDKMVCINVNSLVEEVTAANRLQLERAQSSSQFYFRLSPTIEFTGNMLDRPGERSYSLQ
KSANINAVWATLIIEECCRLGLTYFCIAPGSRSSPLAVSASTHPLTTCISCYDERSLAFH
ALGYAKGSTKPAVVITSSGTAVSNLFPAVVEASQNFVPLLLLTADRPPELLDAGANQAIN
QVNHFGSFVRYFFNLPPPTDDIPARMVLTTLDSAVHWATHAPYGPVHINCAFREPLENTP
KQWRLSCLQGLDLWKSSTEPFTKYIEMHHSHPCIQMDEVVNLIQCANKGLLIIGALQTEN
EMWEALLLAKHLSWPIVADILSGLRFRKVLTSFPEIDEKLLFIDHLDHALLSDSVRSWAH
ADMIIQIGSRITSKRISKMIEACAPCPYIVVDKHPFRHDPSHIVTHRIQSSISAFADCLL
NVDIPRMMTSKWKDCLQALNTMVAREIEFQIRSECSLTEPHVARIISEALPSDAALFIGN
SMVVRDAEMYGCGWTKPAIDVETVRSDSELPCLGIQVAGNRGASGIDGLLSTAVGFAAGC
NKRVFCVVGDISFLYDTNGLAILNHKSRRKPMTIVVTNNHGGAIFSLLPIANVTEPSVLN
QFFYTSHNTSIGKLCEAHSVRHLQVRTKMELREALMIAEQEQTDCLIEVESSIEDNAKFH
RTLSEYACQVADHTFHNLSRLSSLDHISSGFFLCRIHQVDYSLYRIQLSAPPTSTPLSDK
SSVFHREGFLISLYLDDGTVGFGEIAPLEIHKESMLDVEEQLRFLLHTIKGVKISYLLPL
LNGSFSSWIWEQFGIPPTSISPSVRCGLEMAILNAIAAREGCSFSDLLLSHESATPKSKL
LETETTVNRMPRIHICALLDSSGTPEEVAHIAGKLVEEGFTTIKLKVARRGNPLEDGAVI
QEVRKRVGDQIKLRVDANRKWTYEEACQFAATVKFCDLQYIEEPVQLEDDIIKFCEESSL
PVAIDESVDNIQGDLLTGLEKFTHRGIVAVVIKPSVVGGFENAALIAKWAQQQNKMAVVS
AAFESSLSLSTYAQFSHYLEVQNMEICRVKKNKELHEPIAHGLGTYKWLKEDVTSEPLKI
LGRPYSDTVAASLKDSAIALQKFKIDPKIVQRSYSGEQFKTYELKVDHENYSCSFKVHET
GIETNNNVLVFLHGFLGTSGDWISIMKPFSSTARCISIDLPGHGGSKVHNHGNNKANQDS
FISTEVISNLLSKLIHKLTNTRVVIIGYSMGARIALQMALRYNNQINGAVIISGSPGIKD
GERRRSRRAQDDAKARFLTEHGLQFFLETWYTGALWKSLRDHPNFKQIISSRMQHDDVHS
LARSLSDLSTGRQPSLWEELKHCKKPLLFVVGEKDKKFKKIAQEMCHEISLIPNNNSKET
PQMVEVPDCGHAVHLENPLPLISTISQFWRKLD
NT seq 4962 nt NT seq  +upstreamnt  +downstreamnt
atggaagctggtggtgatgatgatgatgaagaggaggaggattctgaattaccagtagag
cttagttatacaagaacattacctccagctttgacatttgaacatggaattaaaaagatt
aaagttgaaatcgataaattgaaattgaactcacctagttctagaagcggcattttgcgg
tttcaggttgcagtcccaccaagcacaaaggcatggaattggttgtgcaatcaacctcag
acaccagaagtgtttccgcagttttatctttctaagatggatgttgataaagaaggtgtt
gacttgcatttacctaatggattgcttggagtttccggagtcagtgctgctgctcaattt
acgtgtaaaactacagatgcctccaaagaacgaagctcaatcaaaaggtacctttcagtt
gcttcacccttgattagagcttatggattcgttggcatacatttcgacacagaatcatat
aaaatgaggcgtgagaatggttcgtcttattatttcatccctcagcttgagctggatgaa
tatggcagtacttcactcttagcagcaacactggcctgggattattcttcacctcgttcc
ttcaacgaagccatgaggtctttggagctatctcttgaccaggtggtcagtggtttatca
atttcagatgagatctgccagaataagtttgttagctctggtctcactcaggctaatctg
gtggatgacaaaatggtatgtataaatgttaattcgctagttgaagaggttactgctgct
aaccgtttgcaactggaaagggctcaaagttcttctcagttttatttcaggctctcacca
accattgaatttactggtaacatgttggatcgtcctggtgaaaggagttactcattgcaa
aagtctgccaacatcaatgctgtgtgggcaacacttattattgaggaatgctgtagactt
ggtttgacgtatttttgcattgctccaggatcaagatcgtctccacttgcagtttctgca
tctactcaccccctcacaacttgtatttcatgctatgatgaacgctcacttgcttttcat
gctcttggctatgcaaaagggtctaccaaaccagcagtagtaataacgtcatcaggcact
gcagtctccaatctttttccagcagttgtggaggctagtcaaaattttgtgccactttta
ttgctcacagcagatcgtcctccagagctgctggatgctggagcaaaccaagccatcaat
caggtcaaccatttcggttcatttgtgagatatttcttcaacctacctcctccaactgat
gatattcctgcacgaatggttcttacaactcttgactctgctgttcactgggcaacccat
gcaccatatggtcctgttcatattaactgtgctttcagagagccattagaaaatactcca
aaacaatggaggttgagctgcttgcaaggattagacctttggaaatcaagtactgaacca
ttcactaaatacatagagatgcatcattcacatccatgtatacaaatggatgaggttgta
aacttgattcaatgcgctaacaaagggctgctcataataggagcccttcaaacagagaat
gagatgtgggaagctcttctcttggctaaacacctctcctggcctattgtagctgacatc
ttgtcgggtctacgatttagaaaagttttgacttcatttcctgaaattgatgaaaaacta
ctttttatagatcatcttgatcatgctcttctctcagattcagtcagaagctgggcacat
gcagatatgataattcagataggtagcaggataacgagcaaacgcataagtaagatgata
gaggcctgtgctccatgtccatacattgtggttgacaagcatccttttcgtcacgatcct
tctcatattgtaactcataggattcaaagttcgataagtgcatttgctgattgtttactg
aatgttgacattccaaggatgatgaccagcaaatggaaggattgtctgcaagctttgaat
acaatggttgctcgggaaattgaattccaaatacgttctgaatgctcactgactgaacct
catgttgcacgcataatttcggaagcacttccaagtgatgctgcattgtttatcgggaac
agcatggtagttcgtgatgcagagatgtatgggtgtggttggacgaaacctgcaattgat
gttgaaactgttaggtcagattcggagttaccatgcctcgggatacaagtggctgggaat
aggggagcaagtggtattgatggattacttagtacagctgttggttttgcagcgggatgc
aataagcgagtgttttgcgttgttggggacatttctttcctttatgatacaaatggattg
gcaattttgaatcataagtcaaggagaaaaccaatgacgattgttgtgacaaacaatcat
ggcggagcaatttttagtcttcttccgattgcaaatgtaactgaaccaagtgtactaaac
cagttcttctacacctcccataacacgtccattggcaagctgtgtgaagctcatagcgtg
aggcatttacaagtgcgaacaaaaatggaactccgagaagctttaatgatagcagagcag
gaacagaccgactgcttaatagaagttgaaagcagcatcgaagacaatgctaagtttcac
agaaccttgagtgaatatgcttgtcaagtagcagatcatacctttcataacctatcaaga
ctttcatctttggatcatatatcgagtgggttcttcctttgtaggatccaccaagtggat
tattcattgtataggattcaactctctgctccacctacttctactcccctcagcgataag
tcctctgtatttcatagagaagggttccttatatctttgtatcttgatgatggaactgta
ggttttggtgagattgcccctcttgagatccacaaagaaagtatgttagatgtggaggag
caactacggtttcttctacacacgatcaaaggagttaagattagttatctccttcctttg
ctcaacgggtcattctcttcctggatttgggaacaatttggtattccgccaacctcaata
tcaccaagtgttagatgtggtttggagatggcaatcctcaatgcaatagcagcaagagaa
ggttgtagtttttcagacttgctgctcagtcatgaatctgcaactcccaagtcaaaatta
cttgaaacagaaaccacggttaataggatgccaagaatacatatatgtgcccttctagat
tctagtgggacgcctgaggaggtggctcatattgccgggaaactagttgaagaaggattt
accactataaagctgaaggttgcacgcagaggaaatcccttggaggatggtgctgttatc
caagaagtgaggaaaagggttggggaccagatcaaactacgtgtagatgctaaccgaaaa
tggacgtatgaagaagcgtgtcagtttgcagctactgtgaagttttgtgacctgcagtat
attgaggaacctgtgcaactggaagatgatattatcaaattttgtgaagaaagtagttta
cctgtagcgatagatgaatctgttgacaacatccaaggagatcttctcactgggcttgaa
aaattcacacacagaggaatagttgctgtagttattaaaccaagtgtcgttggtggattt
gaaaatgcagctttgattgctaagtgggctcagcagcagaataagatggctgttgtcagt
gctgcatttgagagcagtctcagtttatctacatatgctcagttttcacattatcttgaa
gtccaaaatatggaaatatgcagagtgaagaagaataaggaactacatgaacctatagcc
catggccttggaacatataaatggctcaaggaagatgttaccagtgaaccgctaaagatt
cttggtcgtccttatagtgacacagtagctgcatcactgaaagattctgcaattgcactt
caaaagttcaaaatcgatcctaaaatcgttcagcgtagttatagtggggagcaatttaaa
acgtatgaactaaaggtggatcacgagaattacagttgttctttcaaagttcatgagact
ggaatagaaacaaataacaatgtacttgtctttctgcatggatttctaggaactagtgga
gactggatttccattatgaaaccattttcatcaactgcaagatgcatttcaatcgactta
ccaggccatgggggatcaaaggttcataatcacggcaacaataaggcaaatcaagactca
ttcatatcaactgaagtaatttcaaatctattgtccaagctaattcacaagttgaccaat
actagagtggttattatcggatattcaatgggagcaaggattgcattacaaatggcgctg
agatacaataatcagatcaatggagctgttataatatcgggaagtcctggaataaaggat
ggtgaaagaaggcgaagcagaagggctcaggatgatgcaaaggcccgattcctcacagaa
catggtttgcagttcttcttggaaacctggtacactggggcgttgtggaagagcttaaga
gaccatccaaactttaagcaaatcatatccagccgtatgcagcatgatgatgttcactct
ctagcaagatctctatccgatttaagcactgggaggcaaccctccttgtgggaagagtta
aagcactgcaagaaaccgctgttgtttgttgttggagaaaaggataaaaagttcaagaaa
attgctcaagagatgtgccacgaaattagcctaattccaaataacaacagcaaagaaact
ccacaaatggtcgaggttcctgattgtggtcatgctgttcatctcgagaatccccttcct
cttatcagcacgataagccagttttggagaaaactggattag

DBGET integrated database retrieval system