KEGG   Papaver somniferum (opium poppy): 113282240Help
Entry
113282240         CDS       T05758                                 

Definition
(RefSeq) wall-associated receptor kinase 5-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
psom  Papaver somniferum (opium poppy)
Brite
KEGG Orthology (KO) [BR:psom00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:psom01001]
    113282240
Enzymes [BR:psom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113282240
Protein kinases [BR:psom01001]
 Serine/threonine kinases: TKL group
  IRAK family
   113282240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr GUB_WAK_bind EGF_CA cEGF WAK Plasmod_Pvs28 EGF EGF_3 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 113282240
NCBI-ProteinID: XP_026387002
Position
5
AA seq 780 aa AA seqDB search
MASYLFLKFQCFILLLLWLQLASTTEIPITASSSIAKPGCRDKCGNISIPYPFGMGDGCF
LNKYFNITCNESLPKPAAYRSVFNISNISISDGEMTVEQPIATDCSGVGIDIYNRFSKFT
FSHTKNKFFAIGCNTYAYLEINGNASTATGCMSICNTVGDTTNGSCTGIGCCQAGSIPAG
VKVFNVTVGSLNVSRRLDFNPCSYAFLAEESSFNFSSSYLKDFKTRGSGMVPVVADWTIG
NETCQEAQRNLTTYACGRNTDCIHGKGPGYRCSCKPGYTGINPYLDCQDIDECNLQKNPC
THGSYCINTEGSYQCPCIKGYTSEFRDGNMTCIPIPESIFRNRIFVGTCLSLSVLLLSLV
TSIWLYWGYRKRKHLKVKEEFFKQNGGLILSRLLNERQEDVETSRNGRGGKKKAGQLLLA
TIYTESELSKATNNYHENQILGRGGFGTVYKGTLANGDVVAIKKTKIVDRNQNEQFMNEI
AVLSQINHKNVVQLLGCCLESEVTLLVYEFISNGTLHQHLHEYSENQTAGSATLSWENRL
RIASEVAGSLAYLHAEASIPIIHRDVKSSNVLLDDDYKAKVSDFGASRLNPTDQAQLSTV
VQGTFGYLDPEYMLSNQLTEKSDVYSFGVLLVELLTGKAVFSPDRLEEERNLANYFLSSL
RTNRLFAILDGNLVRYDDNERISSVDVHQQIQETAELAQKCLRVKGEKRPTMKEVAMVLH
GLMRSSSSYPGGRMDDEELPNNSKEEFMLLLESANLSYTDSMTTIGDSSKGTLALETEGR
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atggcttcatatcttttcctaaagtttcagtgtttcatcttgttattactatggctgcaa
ttagcatctaccacagagataccgatcactgcttcctcatcaatagcgaagcctggctgc
cgagataagtgcggtaacatcagcatcccctacccgtttggtatgggcgatggatgtttc
ttgaataaatacttcaatataacatgcaatgagagtctccctaagcctgcagcgtaccgg
tcggtctttaatatctcgaatatatcaatttctgatggcgagatgacagtcgaacaaccc
atagccactgattgttccggtgtgggaatagatatctataatagattcagcaaatttacc
ttctctcatactaaaaacaagttctttgcaattggttgcaacacatatgcatatttagaa
ataaatggtaatgcatctactgctacgggatgcatgtcaatctgtaatacagtgggggat
accaccaatgggtcttgcactggtatcggttgttgtcaggcaggttccattccagctgga
gtaaaagtgtttaatgtgacagttggaagcctaaatgtatcccgtcgtttggattttaat
ccatgtagttatgcttttttagctgaagaaagttcatttaacttttcttcatcatatctc
aaagatttcaaaactcgtgggtccggaatggttcctgtggtggccgattggaccattggt
aatgagacatgtcaagaagctcaaagaaacttgacgacctatgcatgtgggcgtaacacc
gactgtatacatggcaaaggtccaggttatcgttgtagttgtaaaccaggatatacaggg
attaatccttatctagattgccaagacattgatgaatgcaatctgcaaaagaatccatgt
acacatggaagttactgcataaatacggaagggagctatcaatgcccttgcataaaggga
tatacttctgaattcagggatggtaacatgacatgcattccaattcctgagagtatcttt
cgtaacaggatttttgttgggacttgcctgagcttatcggttttacttttgagtcttgtg
actagcatttggttgtattggggatataggaaaagaaagcatttgaaagtcaaggaggaa
ttctttaagcaaaatggtgggttgattttaagtcgactccttaatgaacggcaagaagat
gtcgagactagtagaaatggcagaggaggaaaaaaaaaagccggtcagttgctacttgct
acaatatataccgaaagtgagctaagcaaggccacaaacaactatcatgaaaatcaaatt
cttggacgcggagggtttggcacggtgtataaaggaaccttggctaacggagatgtggtt
gcaattaagaagactaagatagtcgacagaaaccaaaatgaacagttcatgaacgagatt
gctgttctatcacaaatcaatcacaaaaatgtggttcagctcttgggctgttgtctcgag
agcgaagttactttactggtttatgaatttataagtaatgggacccttcaccaacattta
cacgaatattcagaaaatcaaactgctggttccgctactctttcatgggaaaatcgttta
aggatcgcctcagaagttgcaggatcattagcttacttgcacgccgaagcttcaataccc
atcattcacagagacgtcaagtcaagtaatgtacttcttgatgatgattacaaagcaaaa
gtttcggatttcggtgcttcaagattgaatcctaccgatcaagctcagttaagtacagtt
gttcaaggtacttttgggtacttagatccagaatacatgttgtcaaaccaattaacagag
aaaagcgacgtgtacagctttggcgttcttcttgtggaattgttaacaggtaaagcagta
ttttctccagacagacttgaagaggaaagaaatttggcaaattattttctttcttctctc
agaaccaacaggttgtttgcgattcttgatggtaatttggtgaggtatgatgataatgaa
cggatcagtagtgtggatgtgcaccaacagatccaagaaacggctgaactagcacaaaaa
tgcttaagagtgaagggagaaaagagacctacaatgaaagaagtagcaatggtgctacac
ggattgatgagatcgtcttctagttatcctggtgggcgcatggatgatgaggaattacca
aacaacagcaaagaagaattcatgctcttgttagaatcagccaatctgtcttacacggac
agcatgacaacaatcggtgatagtagcaaaggaacactggccttagaaaccgagggacgt
taa

DBGET integrated database retrieval system