KEGG   Papaver somniferum (opium poppy): 113282553Help
Entry
113282553         CDS       T05758                                 

Definition
(RefSeq) DEAD-box ATP-dependent RNA helicase 27-like
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
psom  Papaver somniferum (opium poppy)
Brite
KEGG Orthology (KO) [BR:psom00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:psom03041]
    113282553
   03009 Ribosome biogenesis [BR:psom03009]
    113282553
Enzymes [BR:psom01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     113282553
Spliceosome [BR:psom03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    113282553
Ribosome biogenesis [BR:psom03009]
 Eukaryotic type
  90S particles
   Helicases
    113282553
  Pre-60S particles
    113282553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD DUF4217 Helicase_C ResIII AAA_19 PhoH DUF2075 Pox_Ag35
Motif
Other DBs
NCBI-GeneID: 113282553
NCBI-ProteinID: XP_026387370
Position
5
AA seq 570 aa AA seqDB search
MDSSDEEINHENEGVIMNQKRKRDRKKKESKKQVEIPVSESEEEEEEEEDLIDRIEEQEE
DGDEEEEDTDEDDEEDEDGDEEEEVEEEEEEEEADVAFSDLGLSEPTMNAVRDIGFENMT
RVQARAIPQLLKRKNVLGIAGTGSGKTLALLIPAVELLYKKKFSSHNGTGVVVICPIREL
AMQTHAAAKDLLKYHTQTLGLVMDGAARRGEAERLVKGVNLLIATPGRLLDHLQNTKGFI
YKNLKCLIVDEANRMLEENFEEQMKQIIKLLPKEKIKKIKNGEKITILVRNTALFSATQT
TKVEDIAHLLFKSIPVYVNVDDGMSESTVEGLQLGYCVVPSARRFILLYSFLKRNLSKKV
MVFFSSCCSVKYHLELLRHLHVDCFDIHGKQNQQKRTSTFSDFCEAEKGILLCTDVARGL
DIPAVDWIVQYDPPDEPKEFIHRVGRTAHDENANGNALLFLIPEELQFLQFLKAAKVPLK
EYAFDEKKLTKVQSQLEGVVAKNYYLNMSAKEAYRSYILAYNSHSMKEIFNVHKLDLQAV
ATSFCFSGPPKIYLAPDSSRSKSRKKSRKN
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggatagttcagacgaagagattaaccatgaaaatgaaggggttataatgaatcagaag
aggaagagagataggaagaagaaggaaagtaagaaacaagtagaaataccagtctcagaa
agtgaggaggaggaggaggaagaagaagatcttattgatagaattgaagaacaagaagaa
gatggagacgaagaagaagaggatacagatgaagacgacgaagaagacgaggatggagat
gaagaggaagaggtagaggaagaagaagaagaagaagaggcggatgttgctttctctgat
ttaggcctctctgaacctaccatgaatgctgttagagatattggttttgaaaatatgact
cgggttcaagctagagctattccacaacttctgaaacgaaagaatgttcttggaattgca
gggacgggttctgggaagaccctagctttattgataccagccgttgaattgttgtacaag
aaaaagttcagttcgcataatggaactggggtggttgtcatttgcccgatcagagaactt
gctatgcagacacatgctgcggctaaggaccttctcaagtaccacactcagactcttggg
ctggttatggatggtgcagctcgaagaggagaagcagaacgccttgtgaaaggagtaaat
ctgttaattgctacccctggcagacttcttgatcatcttcagaataccaagggatttatt
tataaaaatttgaagtgcctcatagttgatgaagctaatcgaatgctggaagagaacttt
gaggagcaaatgaagcagattataaagcttcttccaaaggaaaagataaaaaagattaaa
aatggcgaaaagatcactattttggtgagaaacacagcgctgttttccgccactcagact
acgaaggtcgaagatattgcacacttgttatttaagtccatcccggtgtatgttaatgtg
gatgatggcatgtccgagtccacagtagaaggattgcagctaggttactgcgttgtgcca
agtgctaggagattcattctgttgtattccttcttgaaaagaaatctgtccaagaaagtt
atggttttcttctcttcatgctgttctgtaaaatatcacttggagcttctgaggcacctt
catgtggactgctttgatatccatggaaaacaaaaccagcagaagcgtacgtcaaccttt
tctgatttctgcgaggcagagaaaggcatcttattatgtacagatgttgctcgtgggctt
gatattcctgctgtggactggatcgtgcagtatgatcctccagatgagcccaaggagttc
atccacagggttggtcgaacagctcatgatgaaaatgcaaatggaaatgcgcttctcttc
ttaataccagaagagttgcaatttttacaatttctaaaggcagcaaaagtaccgctgaaa
gagtacgcatttgatgaaaagaagctaacaaaagtgcaatctcaattggagggagtggtg
gccaaaaactattatctaaatatgtcagcaaaagaagcatacagatcgtatatattggcc
tataattcacattctatgaaggaaatcttcaacgttcacaaactcgacctgcaggctgtt
gctacttccttttgcttttctggtccaccaaagatatatctggcacctgatagcagtaga
tcaaaatctagaaagaagagtcgtaaaaattga

DBGET integrated database retrieval system