KEGG   Papaver somniferum (opium poppy): 113283118Help
Entry
113283118         CDS       T05758                                 

Definition
(RefSeq) cell division cycle 5-like protein
  KO
K12860  pre-mRNA-splicing factor CDC5/CEF1
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    113283118
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:psom03041]
    113283118
   03400 DNA repair and recombination proteins [BR:psom03400]
    113283118
Spliceosome [BR:psom03041]
 Complex B
  Other components
   Prp19 complex
    113283118
 Complex C
   Prp19-CDC5 complex
    113283118
DNA repair and recombination proteins [BR:psom03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   PSO4 complex
    113283118
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myb_Cef Myb_DNA-binding Myb_DNA-bind_6 Rap1_C
Motif
Other DBs
NCBI-GeneID: 113283118
NCBI-ProteinID: XP_026388057
Position
5
AA seq 992 aa AA seqDB search
MRIMIKGGVWKNTEDEILKAAVMKYGKNQWARISSLLVRKSAKQCKARWYEWLDPSIKKT
EWTREEDEKLLHLAKLMPTQWRTIAPIVGRTPSQCLERYEKLLDAACVKDENYEPNDDPR
KLRPGEIDPNPESKPARPDPVDMDEDEKEMLSEARARLANTRGKKAKRKAREKQLEEARR
LASLQKRRELKAAGIDNRQRKRKRKGIDYNAEIPFEKKPPAGFYDIVDEDRPVEQPQFPT
TIEELEGKRRADVEAQLRKQDVAKNKIAQRQDAPSSVLQVNKLNDPETVRKRSKLMLPAP
QITDHELEEIAKMGFASDLLAGSEAEGSGATRALLANYSQTPRHGMTPFRTPQRTPGGKA
DAIMMEAENLARLRESQTPLLGGDNPDLHPSDFSGVTPKRRDIQTPNPMATPLSTPGASG
VTPRIGMTPSNDAYSSGMTPRGTPLRDELHINEDMDMPESLKHDLRRQAELRRNLQSGLI
NLPQPRNEYQIVIQPLPQDNDEPEDMIEEDMSDRIAREKTEEEARQQALLKKRSKVLQRE
LPRPPSASLELIRNSLVRTDEDKSSFVPPTPIEQADEMVRKELLGLLEHDNAKYPLDEKV
EKEKKKGGKRASNGKSAFIPEIEDFEEEEMKEADLLIREEIQFLRVAMRHENEPVDEYVR
VHDACLEDIMYFPARGAYGLSSVANNMEKLGALQNEFENVKKRMDDETKKAQRLEQKIKL
LTHGYQMRGGKLWTQAEATFKQMDTAATELECFQALQKQEQLAASYRINGLEEEIKKQKE
LEKNLQHRYGNLIAEQDKIERLFEEYRSQEKLQEESNAREFDLPSATNETDNAQSNGEQN
STATMDVDTSIAAVEEDKEVQLQGSNCEGPTDEMKIDPSTDSMAVDLGGSAEISEEETNG
LGCDGNQMSEIPKENEPEIPKENEQIIDTISDQNSKADDISSNGDGITQHAADDLSKEAP
SADENLIQKPTEMVDAVTDLVSETTEGGDGRE
NT seq 2979 nt NT seq  +upstreamnt  +downstreamnt
atgaggattatgattaagggtggtgtttggaagaacaccgaagatgaaattcttaaagct
gcggttatgaagtatggtaaaaatcaatgggctagaatatcatctcttcttgttcgtaaa
tctgctaaacaatgtaaagctaggtggtatgagtggctcgatccatctattaaaaagacc
gagtggacccgagaagaagatgagaaactgctccatcttgctaaacttatgccaacacaa
tggagaacaattgctccaattgtcgggcgaactccttctcagtgtcttgagcgttatgag
aagctgcttgatgccgcttgtgttaaggatgagaattatgaacccaatgacgatccaagg
aagttgcgtcctggagagattgatcctaatcctgagtcaaagcccgctcgtcctgatcct
gtcgatatggatgaagatgagaaggaaatgctttctgaagcacgtgctagattagccaac
actagggggaaaaaagcaaagagaaaagccagggagaagcagctcgaggaggcgaggagg
cttgcttctttgcagaaaaggagggaactaaaggcagctggaattgataataggcagcga
aagaggaaaaggaagggtatagattataatgccgagatcccctttgagaagaagcctcca
gcagggttctatgatattgtggatgaggacagaccagtggaacaacctcagtttccgacc
accatcgaggaacttgagggcaaaaggagggctgatgtggaagcacagttaagaaagcag
gatgttgccaaaaacaaaattgctcagaggcaggatgccccatcatcagtattgcaagtt
aacaagctaaacgacccagaaactgttaggaagaggtcaaaactgatgcttcctgcacca
caaataacagatcatgaattggaggagattgcgaagatgggttttgctagtgatcttctt
gcagggagtgaggcggaaggaagtggtgctacacgtgcacttcttgcaaattactctcag
acccctcgacatggaatgacaccttttagaactccccaaagaacacctggtgggaaggcg
gatgcgattatgatggaggctgagaaccttgctaggttgagagagtcccaaaccccatta
cttggtggtgataatccagatttgcatccatctgacttttcaggtgttacaccgaaaagg
agggatatccagacgcctaacccgatggctactcctttatctactcctggagccagtggt
gtcacccccagaattggcatgacaccatcaaatgatgcgtattcatcaggtatgacaccc
agaggaactcctcttcgagatgagcttcacattaatgaagatatggatatgcctgagagt
ttgaagcatgacctccgtagacaggctgagttaagaagaaacttgcaatctggtttaatc
aaccttccacaacccagaaatgagtatcaaatagtaatccaaccacttcctcaggataat
gacgaacccgaggatatgattgaagaagacatgtcagatagaatagctagagagaagact
gaagaagaagcaagacagcaggcattacttaagaagagatcaaaagtacttcaaagggag
cttcctagacctccttctgcttcactggagcttattaggaactcattggtgaggactgat
gaagacaagagttctttcgttcctcctactccgattgagcaggctgatgagatggtgaga
aaggagcttttaggtttattggagcacgataatgccaaatacccacttgatgagaaagta
gagaaggagaaaaagaaagggggaaaacgtgcctcaaacggaaaatcagcctttattccc
gagattgaggactttgaagaagaagaaatgaaagaggctgatttattgataagggaagag
attcagtttctccgtgtggcaatgcggcatgaaaatgaaccggttgatgaatatgtcaga
gttcatgatgcatgcctagaagatatcatgtactttcctgctcgtggtgcctatggtctc
tcaagtgtcgctaataacatggagaagctgggagccttgcagaatgagtttgagaatgtg
aaaaagaggatggatgatgaaactaagaaagcacaacgccttgaacagaagataaagctg
ctcacacatggttaccagatgcgtggtggaaaactttggacccaagcagaggccaccttt
aaacagatggatactgctgctacagaacttgaatgctttcaagctttacaaaagcaagag
cagttggcagcgtcctacaggatcaatggcttggaggaagaaatcaagaagcagaaggag
cttgagaaaaatcttcagcaccgatatgggaacctcattgcagagcaggataagattgaa
aggcttttcgaagaatatcgatcacaagaaaaattacaggaagaaagtaatgcacgcgag
tttgatttgccatctgctacgaatgaaacagataatgctcagtccaatggtgaacagaac
tcaactgcaaccatggacgtagatacatctattgctgcagtagaggaagacaaagaagtt
caattacaaggaagtaactgcgaaggccctactgatgagatgaagatcgatccaagtact
gactcaatggcagttgatttagggggcagtgctgaaatttccgaggaagaaacaaatggg
ttgggttgtgatggtaatcaaatgtctgaaataccaaaggagaacgagcctgaaatacca
aaggagaacgagcaaattattgatacaatttctgatcaaaacagtaaagcagatgatatt
tctagcaatggagatggtataactcaacatgcagccgatgatttatcaaaggaggctcca
tctgcagatgagaatttgattcaaaagcctactgaaatggttgatgccgtcactgatttg
gtctcagaaactactgaaggtggggatggtagggagtga

DBGET integrated database retrieval system