KEGG   Papaver somniferum (opium poppy): 113283567Help
Entry
113283567         CDS       T05758                                 

Definition
(RefSeq) probable L-type lectin-domain containing receptor kinase S.5
Organism
psom  Papaver somniferum (opium poppy)
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_legB Pkinase Pkinase_Tyr Bact_lectin Haspin_kinase SKG6 Kinase-like 7tm_2
Motif
Other DBs
NCBI-GeneID: 113283567
NCBI-ProteinID: XP_026388667
Position
5
AA seq 698 aa AA seqDB search
MSKSKNIITAIIFLSCFLIIFPSNSSAEKNSYYPFYRKGFNHTSDSQFFTTLGTASIHGG
ALQITPDTMNDKSYLIEKSGRAMFNRRFKIWEESKTGNASSDVILSFNSTFTINVYPTVP
KVSPAEGLAFIIAPNIIDFPSNSHGEYLGLTNSSTDGNPNNRFVAIEFDTSKQAFDPDNN
HIGLDINSVNSTKTVSLSDYGIVIAPDQDVTKNNTVWIQYNGTTKVLDVYMALEGSPRPK
HPLLSEIINLKTHLNQYSYFGFAASTGKTAQLNCVLMWNLTVEVLPEEKDHTKLYIGLGV
GIPAVIILVVLLGIYGYYWNKQRHVDDPNILGALKSLPGTPREFLFKELKKATNNFDDKM
KLGQGGFGVVYKGVLASENNTPIAVKKFSRESIKGKDDFLSELTIINRLRHKHLVRLEGW
CHKNGMLLLVYEYMPNGSLDHHLFGGSEKTLSWGHRYKITYGIASGLHYLHNEYNQKVIH
RDLKANNILLDSNFNARLGDFGLARAIDNERTSYAELEGVPGTIGYIAPECFHTGKGTRE
SDIYGFGAVVLEVVCGQRPWTKVGGFNCLVDWVWKLYREGRILDAVDKRLGEDYVPEEAE
KLLLLGLACSHPIANERPKTQLIFQIVSGSGQVPLLPPFKPAFVWPSMEPLDGEEGSTTS
NTPDETPMNSSFYGTSGWSLDGESRESYVRYSDITTKV
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaatcaaaaaacataatcactgcaattatcttcctttcatgttttcttatcatc
tttccctcaaattcttcagcagaaaagaacagttattatcctttctatagaaagggattc
aatcacacatccgattcccaattcttcacaactctaggtacagcttcaattcatggagga
gctcttcaaataactccagatacaatgaatgacaaaagctatctcatagaaaaatctggt
cgtgctatgttcaaccgcagattcaagatttgggaagaatcaaaaactggaaacgcttct
tcagatgtgattctttctttcaattcaacttttactataaatgtttatcctactgtacca
aaagtatcccctgctgaaggtttagcttttataattgctcctaatattattgattttcct
tcgaatagtcatggtgagtacttggggttaacaaatagttctacagatggaaatccaaac
aatagatttgttgcaatcgagttcgatacatccaaacaagctttcgacccggataataac
catattgggttagatatcaacagtgttaattcaaccaaaacagtttctttatcagattat
ggtattgttatcgctccggatcaggatgtgacgaagaataacacagtttggatccagtac
aatggcactacgaaggttcttgatgtttacatggcacttgaaggaagccccagacctaag
cacccgttactcagtgaaatcattaacctaaaaactcatctcaatcaatactcttacttt
ggattcgcagcttcaactggaaaaacagctcagctcaactgcgttcttatgtggaatcta
acggttgaagttcttccagaagaaaaagatcatacaaagttatatatcggattgggtgtt
ggaattccagcagtgataattctggtagttctactggggatttatgggtattactggaat
aaacaaagacatgtcgatgatcctaatattctaggagcattgaaaagtttaccgggaaca
ccaagagagttcttgttcaaagagttgaaaaaagctacaaataatttcgatgataaaatg
aaattgggtcaaggtggatttggagtagtttacaaaggtgtgttagctagtgagaataat
acaccgattgcagtcaagaaattctcaagagaaagcatcaagggcaaagatgatttctta
tctgaactcaccatcatcaatcgtctccgccataaacatctcgtccgccttgaaggttgg
tgtcataaaaatggaatgttactgctggtatacgagtacatgccaaatgggagtcttgat
catcatctattcggtggctctgagaaaactttgagttggggtcatcgatacaagatcaca
tatggtattgcatccggtttacattatctccacaacgagtacaaccagaaggtgatacac
agagatctcaaagccaacaatatattgctcgattcgaatttcaatgctcgattaggtgat
ttcggtttggctcgtgcaatcgataatgaacggacgtcatatgcggagcttgaaggggtg
cctggaacaattggatatattgcacctgaatgctttcatacagggaaaggcacgagagag
tctgatatttatgggtttggagctgttgttcttgaagtggtatgtggtcaaagaccatgg
actaaagtcgggggttttaattgtttggttgattgggtctggaaattataccgagaaggg
cgaattttggacgcagttgacaaaagattgggtgaggattatgtgccagaagaagcggag
aaactgctgttactaggacttgcttgttcacatcctatagcaaatgaaagaccaaaaaca
caactcatctttcagattgtgtccggatcagggcaagttcctttacttcctcctttcaaa
cctgctttcgtatggccaagtatggaaccattagatggagaagaagggagtacgacatca
aatacacctgatgaaacacctatgaattcctcattttatgggacttcagggtggagtttg
gatggtgagagcagggaaagctatgtcagatatagtgatatcaccactaaggtctag

DBGET integrated database retrieval system