KEGG   Papaver somniferum (opium poppy): 113284198Help
Entry
113284198         CDS       T05758                                 

Definition
(RefSeq) eukaryotic translation initiation factor 2 subunit alpha homolog
  KO
K03237  translation initiation factor 2 subunit 1
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom03013  RNA transport
psom04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    113284198
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113284198
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:psom03012]
    113284198
Translation factors [BR:psom03012]
 Eukaryotic type
  Initiation factors
   eIF-2
    113284198
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EIF_2_alpha S1 Herpes_U47
Motif
Other DBs
NCBI-GeneID: 113284198
NCBI-ProteinID: XP_026389397
Position
5
AA seq 342 aa AA seqDB search
MASNTPNLECRMYEARYPEVDMAVMIQVKNIADMGAYVSLLEYNNIEGMILFSELSRRRI
RSVSSLIKVGRQEPVMVLRVDKDKGYIDLSKRRVAEEDIATCEERYNKSKLVHSIMRHVA
ETMQLDLEDLYIHVGWPLYRKYGHAFEAFKLIVADPDTILDSLTREVKEVGPDGQEVTKV
VPALTEEVKDALIKNIKRRMTPQPMKIRADIEMKCFQFDGVLHIKEAMRKAEATGNDDCP
VKIKLVAPPLYVLTTQTLDKDQGIKVLTNAIQACTEAIDSHKGKLVVKEAPRAVSERDDN
LLAQHMAQLRQSNEDVDGDDDSEEEDTGMGEIDVDGPVGVHE
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgaacactccaaatctggagtgtagaatgtacgaagcaaggtatccagaagta
gatatggcagtaatgattcaagtgaagaacatagcagatatgggtgcttatgtttccctt
cttgaatacaataacattgaaggtatgattctgttcagtgagctttcacgaagacgtatt
cgaagtgttagtagtttgattaaagttggtagacaagaaccggttatggttcttagggtt
gataaagataaaggttatattgatttgagtaaaagaagagttgctgaagaagatattgct
acttgtgaagaaagatataataagagtaaacttgttcattctattatgaggcatgttgct
gagactatgcagctcgatttggaggatctgtatatccatgttggctggcctctatatcga
aaatatgggcatgcatttgaggcattcaagttgattgtggctgatcctgatactattctc
gattccctcacacgtgaagtcaaagaagttggtcccgatggacaagaggttactaaagtg
gtacctgctctgacagaggaggttaaagatgctttgattaagaacatcaaaaggcgtatg
actccccagccgatgaaaattcgtgcagatattgaaatgaaatgctttcagtttgacggg
gttctccacatcaaggaggctatgaggaaagctgaagctactggtaatgatgactgtcca
gttaaaattaaactggtggcacctcctctctatgttctgacgactcagacccttgacaag
gatcaagggataaaggttcttactaatgcaatccaagcttgcactgaagcaatagacagc
cacaagggtaaactggtggtaaaggaggcaccaagagcggtgagcgagcgtgacgacaac
ttacttgctcagcatatggcacagcttcgtcaatcgaacgaagatgtagatggtgatgat
gatagtgaagaggaagacacggggatgggagagatcgatgttgacggaccagttggtgtc
cacgagtaa

KEGG   Papaver somniferum (opium poppy): 113299754Help
Entry
113299754         CDS       T05758                                 

Definition
(RefSeq) eukaryotic translation initiation factor 2 subunit alpha homolog
  KO
K03237  translation initiation factor 2 subunit 1
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom03013  RNA transport
psom04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    113299754
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113299754
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:psom03012]
    113299754
Translation factors [BR:psom03012]
 Eukaryotic type
  Initiation factors
   eIF-2
    113299754
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EIF_2_alpha S1
Motif
Other DBs
NCBI-GeneID: 113299754
NCBI-ProteinID: XP_026404625
Position
7
AA seq 342 aa AA seqDB search
MASNTPNLECRMYEARYPEVDMAVMIQVKNIADMGAYVSLLEYNNIEGMILFSELSRRRI
RSVSSLIKVGRQEPVMVLRVDKEKGYIDLSKRRVAEEDIATCEERYNKSKLVHSIMRHVA
ETMQLDLEDLYIHVGWPLYRKYGHAFEAFKLIVADPDTILDSLTREVKEAGPDGKEVTKV
VRALTEEVKDALIKNIKRRMTPQPMKIRADIEMKCFQFDGVLHIKEAMRKAEATGNDDCP
VKIKLVAPPLYVLTTQTLDKEQGIQVLTSAIQACTEVIDGHKGKLVVKEAPRAVSERDDN
LLAQHMKQLNESNADVDGDDDSEEEDTGMGDIDIDGPAGVHE
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgaacactccaaatctggagtgtagaatgtacgaagctcggtatccagaggta
gatatggcagtaatgattcaagtgaagaacatagcagatatgggtgcctatgtctccctc
ctcgaatataataacatcgaaggtatgattttattcagtgagctttcacgaagacgtatt
cgaagtgttagtagtttgatcaaagttggaagacaagaaccagttatggtacttagggtt
gataaagagaaaggttatattgatttgagtaaaagaagagttgctgaagaagatattgct
acttgtgaagaaagatataataagagtaaacttgttcattctatcatgaggcatgttgct
gagactatgcaactcgatttggaggatctgtatatccatgttggctggcctctatatcga
aaatatgggcacgcgtttgaggccttcaagttaatcgttgctgatcctgataccattctc
gattccctcacacgtgaagttaaagaagctggccctgatggaaaagaggtgactaaagtg
gtacgtgctctgacagaggaggttaaagatgctttgattaagaacatcaaaaggcgtatg
actcctcagccaatgaaaattcgtgcagatattgaaatgaaatgctttcagtttgatggg
gttctccatatcaaggaagcaatgaggaaagctgaagctactggtaatgacgactgtcca
gttaaaattaaactggtggcacctcctctctatgttctgacgactcagactcttgacaag
gagcaagggatacaggttcttactagtgcaatccaagcttgcactgaagtaatagatggt
cacaaggggaaactggtagtgaaggaggcaccaagagcggtgagcgagcgtgatgataac
ctacttgcccaacatatgaaacaacttaatgaatcaaacgcagatgtggatggtgatgac
gatagtgaagaggaagatacagggatgggagatattgatattgatggacctgcaggtgtc
catgagtag

KEGG   Papaver somniferum (opium poppy): 113303575Help
Entry
113303575         CDS       T05758                                 

Definition
(RefSeq) eukaryotic translation initiation factor 2 subunit alpha homolog
  KO
K03237  translation initiation factor 2 subunit 1
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom03013  RNA transport
psom04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    113303575
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113303575
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:psom03012]
    113303575
Translation factors [BR:psom03012]
 Eukaryotic type
  Initiation factors
   eIF-2
    113303575
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EIF_2_alpha S1
Motif
Other DBs
NCBI-GeneID: 113303575
NCBI-ProteinID: XP_026408404
Position
8
AA seq 342 aa AA seqDB search
MASNTPNLECRMYEARYPEVDMAVMIQVKNIADMGAYVSLLEYNNIEGMILFSELSRRRI
RSVSSLIKVGRQEPVMVLRVDKEKGYIDLSKRRVAEEDIATCEERYNKSKLVHSIMRHVA
ETMQLDLEELYIHVGWPLYRKYGHAFEAFKLIVADPDTILDSLTREVKEAGPDGKEVTKV
VPALTEEVKDALIKNIKRRMTPQPMKIRADIEMKCFQFDGVLHIKEAMRKAEATGNDDCP
VKIKLVAPPLYVLTTQTLDKEQGIQVLTNAIQACTEVIDGHKGKLVVKEAPRAVSERDDN
LLAQHMKQLNESNADVDGDDDSEEEDTGMGDIDIDGPSGVHE
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgaacactccaaatctggagtgtagaatgtacgaagctcggtatccagaggta
gatatggcagtaatgattcaagtgaagaacatagcagatatgggtgcctatgtctccctc
ctcgaatacaataacatcgaaggtatgattttattcagtgagctttcacgaagacgtatt
cgaagtgttagtagtttgatcaaagttggaagacaagaaccagttatggtacttagggtt
gataaagagaaaggttatattgatttgagtaaaagaagagttgctgaagaagatattgct
acttgtgaagaaagatataataagagtaaacttgttcattctatcatgaggcatgttgct
gagactatgcaactcgatttggaggagctgtatatccatgttggctggcctctatatcga
aaatatgggcacgcgtttgaggccttcaagttaatcgttgctgatcctgataccattctc
gattccctcacacgtgaagttaaagaagctggccccgatggaaaagaggtgactaaagtg
gtacctgctctgacagaggaggttaaagatgctttgattaagaacatcaaaaggcgtatg
actcctcagccaatgaaaattcgtgcagatattgaaatgaaatgctttcagtttgacggg
gttctccatatcaaggaagcaatgaggaaagctgaagctactggtaatgatgactgtcca
gttaaaattaaactggtggcacctcctctctatgttctgacgactcagactcttgacaag
gagcaagggatacaggttcttactaatgcaatccaagcttgcactgaagtgatagatggc
cacaaggggaaactggtagtaaaggaggcaccaagagcggtgagcgagcgtgatgataac
ctacttgcccaacatatgaaacaacttaatgaatcaaacgcagatgttgatggtgatgac
gatagtgaagaggaagatactgggatgggagatatcgacattgatggaccttcaggtgtc
catgagtag

KEGG   Papaver somniferum (opium poppy): 113316744Help
Entry
113316744         CDS       T05758                                 

Definition
(RefSeq) eukaryotic translation initiation factor 2 subunit alpha homolog
  KO
K03237  translation initiation factor 2 subunit 1
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom03013  RNA transport
psom04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    113316744
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113316744
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:psom03012]
    113316744
Translation factors [BR:psom03012]
 Eukaryotic type
  Initiation factors
   eIF-2
    113316744
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EIF_2_alpha S1
Motif
Other DBs
NCBI-GeneID: 113316744
NCBI-ProteinID: XP_026420674
Position
10
AA seq 340 aa AA seqDB search
MASNLECRMYEAQYPEVDMAVMIQVKSIEETCAYVSLLEYNNIEGMILISELSKRRIRSV
NSVIKVGRQEPVMVITVDGDRGYIDLSKRRVSEEDIAVCEERYNKSKLVHSIMRHVAETM
QLDLEDLYTHVGWPLYRSYGHAYEAFKLIVADPDTILDSLTREVQEVGPDGKEVTKVVPA
LTEEVKDALIKNIRRRMTPQPMKIRADIEMKCFQFDGVLHIKEAMRIAEASGNDDCPIKI
KLVAAPLYVLTTQTLDKEQGIRVLTDAIEACTEKIGSHGGRLVVKEAPRAVTERDDNLLA
EQMRKLNQSSQEVNGDDDSEEEDTGMGEIDVDGPSGVHEQ
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaaacctggagtgcagaatgtacgaagcgcaatatccagaagtggatatggct
gtgatgattcaagtgaaaagcatagaagaaacgtgtgcttatgtctccctcctggaatac
aataacatcgagggtatgatactaataagtgagctttcaaaaagacgtattcgaagtgtc
aatagtgtgataaaagttggaagacaagaaccagttatggtaattacggttgatggagat
agaggctatattgatttgagtaaaagaagagtttctgaagaagatattgctgtttgtgaa
gaaagatataataagagtaaacttgttcattctattatgaggcatgttgctgagactatg
caactcgatttggaggatctgtatactcatgttggatggcctctatatcgaagctatggg
catgcttatgaggccttcaagttaatcgttgctgatcctgataccattctcgattcactc
acacgtgaagttcaagaagttggccctgatggaaaagaggtgactaaagtggtacccgca
ctgacagaggaggttaaagatgctttgattaagaacatcagaaggcgtatgactccacag
ccaatgaaaattcgtgctgatattgaaatgaaatgctttcagtttgatggggttctccat
atcaaggaagcgatgagaatagctgaagctagtggaaatgatgactgtccaattaaaatt
aaactggtggcagctcctctatacgttctgacgactcagactcttgataaggagcaaggg
ataagggttcttactgatgcaatcgaagcttgcactgaaaaaataggtagccacgggggg
agactggtagtaaaggaggcaccaagagcggtgaccgaacgtgacgataacctacttgcc
gaacagatgagaaaacttaaccaatcaagccaagaagtcaatggtgatgatgatagtgaa
gaggaagatacaggaatgggagaaattgatgttgatggaccttcaggtgtccacgagcag
taa

KEGG   Papaver somniferum (opium poppy): 113317999Help
Entry
113317999         CDS       T05758                                 

Definition
(RefSeq) eukaryotic translation initiation factor 2 subunit alpha homolog isoform X1
  KO
K03237  translation initiation factor 2 subunit 1
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom03013  RNA transport
psom04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    113317999
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113317999
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:psom03012]
    113317999
Translation factors [BR:psom03012]
 Eukaryotic type
  Initiation factors
   eIF-2
    113317999
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EIF_2_alpha S1
Motif
Other DBs
NCBI-GeneID: 113317999
NCBI-ProteinID: XP_026421914
Position
1
AA seq 374 aa AA seqDB search
MASNAPNLECRMYEAPYPEVDTAVMIQVKNIEEDMGVYVSLLEYNNIEGMILFSELSRTR
IRSVSSLIKVGRQEPVMVLRVDKDKGYVDLSKTRVNEYDIATCGERYSKSKLVHSILRHV
AETMQLDLEDLYIHVGWPLYRKYGHAYEAFRLIVADPDTILNSLTRKVSEVGPDGQELMP
KLEPALTVEVKDALIENITKEVKDALIKNIKKHIVLQTTIRAHIEMICFHFDGVLYIKEA
MRKAEETGNDDCPVKMKLVVPPLYVLTTQTLDMEQGIMVLTNAIQACTEAIDSHKGKLVV
KEAPRAVSELDDNLRSQSMAYYLFKMKLHEWEKLVLTDPLVSSTSKATAKQTTHLTELKK
KKKKKQTAHLDPFS
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgaacgctccaaatctagagtgtagaatgtacgaagcgccatatccagaagta
gatacggcagtgatgattcaagtgaaaaacatagaagaagatatgggtgtttatgtctcc
cttctcgaatacaataacatcgagggtatgatcttattcagtgagctttcacgaacacgt
attcgaagtgttagtagtttgataaaagttggaagacaagaaccagttatggtacttagg
gttgataaagataaaggttatgtcgatttaagtaaaacaagagttaatgaatatgatatc
gctacttgtggggaaagatacagtaagagtaaacttgttcattctattctgaggcatgtt
gctgagactatgcaactcgatttggaggatctgtatatccatgttggctggcctctatat
cgaaaatatgggcatgcctatgaggccttcaggttaatcgtggctgatcctgataccatt
cttaattccctcacacgtaaagttagtgaagtcggccctgatggacaagagctgatgcct
aaactggaacctgctctgactgtggaagttaaagatgctttgattgaaaacatcacaaag
gaggttaaagatgctttgattaaaaacatcaaaaagcatatagtcctacagacaacgatc
cgtgcacatattgaaatgatatgctttcattttgatggggttctatatatcaaggaagcg
atgaggaaagctgaagaaactggtaatgatgattgtccagttaaaatgaaactggtggtg
cctcctctctatgttctgacgactcagacccttgacatggaacaaggcataatggttctt
actaatgcaatccaagcttgcacagaagcaatagatagccacaagggaaaattggtagta
aaggaggcaccaagagcggtgagtgaactagatgacaacctgcgttcccaaagtatggcc
tattaccttttcaagatgaagttacatgaatgggaaaaattggtgttgacggacccgttg
gtgtcctcgactagtaaagccactgccaaacaaaccacccatttgacggagctaaaaaaa
aagaaaaaaaagaagcagaccgcccatttagaccctttctcttag

KEGG   Papaver somniferum (opium poppy): 113355424Help
Entry
113355424         CDS       T05758                                 

Definition
(RefSeq) eukaryotic translation initiation factor 2 subunit alpha homolog
  KO
K03237  translation initiation factor 2 subunit 1
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom03013  RNA transport
psom04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    113355424
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113355424
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:psom03012]
    113355424
Translation factors [BR:psom03012]
 Eukaryotic type
  Initiation factors
   eIF-2
    113355424
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EIF_2_alpha S1 Herpes_U47
Motif
Other DBs
NCBI-GeneID: 113355424
NCBI-ProteinID: XP_026454065
Position
3
AA seq 342 aa AA seqDB search
MASNTPNLECRMYEARYPEVDMAVMIQVKNIADMGAYVSLLEYNNIEGMILFSELSRRRI
RSVSSLIKVGRQEPVMVLRVDKDKGYIDLSKRRVAEEDIATCEERYNKSKLVHSIMRHVA
ETMQLDLEDLYIHVGWPLYRKYGHAFEAFKLIVADPDTILDSLTREVKEVGPDGQEVTKV
VPALTEEVKDALIKNIKRRMTPQPMKIRADIEMKCFQFDGVLHIKEAMRKAEATGNDDCP
VKIKLVAPPLYVLTTQTLDKEQGIKVLANAIQACTEVIDIHKGKLVVKEAPRAVSERDDN
LLAQHMAQLRQSNEDVDGDDDSEEEDTGMGEIDVDGPVGVHE
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgaacactccaaatctggagtgtagaatgtacgaagcaaggtatccagaagta
gatatggcagtaatgattcaagtgaagaacatagcagatatgggtgcgtatgtttccctt
cttgaatacaataacatcgaaggtatgattctgttcagtgagctttcacgaagacgtatt
cgaagtgttagtagtttgattaaagttggtagacaagaaccagtcatggtgcttagggtt
gataaagataaaggttatattgatttgagtaaaagaagagttgctgaagaagatattgct
acttgtgaagaaagatataataagagtaaacttgttcattctattatgaggcatgttgct
gagactatgcagctcgatttggaggatctgtatatccatgttggctggcctctatatcga
aaatatgggcatgcatttgaggcatttaagttgatcgtggctgatcctgatactattctc
gattccctcacacgtgaagtcaaagaagttggccctgatggacaagaggttactaaagtg
gtacctgctctgacagaggaggttaaagatgctttgattaagaacatcaaaaggcgtatg
actccacagccgatgaaaattcgtgcagatattgaaatgaaatgctttcagtttgacggg
gttctccacatcaaggaagcaatgaggaaagctgaagctactggtaatgatgactgtcca
gttaagattaaactggtggcacctcctctctatgttctgacaactcagacccttgacaag
gagcaagggataaaggttcttgctaatgcaatccaagcttgcactgaagtgatagatatc
cacaagggtaaactggtagtaaaggaggcaccaagagcggtgagtgagcgcgatgacaac
ttacttgctcagcatatggcacagcttcgtcaatcgaacgaagatgtagatggtgatgat
gatagtgaagaggaagatacagggatgggagagatcgatgttgacggaccagttggtgtt
cacgagtaa

DBGET integrated database retrieval system