KEGG   Papaver somniferum (opium poppy): 113284311Help
Entry
113284311         CDS       T05758                                 

Definition
(RefSeq) E3 ubiquitin protein ligase RIN2-like
  KO
K10636  autocrine motility factor receptor [EC:2.3.2.27]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113284311
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:psom04121]
    113284311
Enzymes [BR:psom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     113284311
Ubiquitin system [BR:psom04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    113284311
  Multi subunit Ring-finger type E3
   ERAD complex
    113284311
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-RING_2 CUE zf-C3HC4 zf-rbx1 zf-RING_UBOX zf-ANAPC11 zf-RING_11 zf-C3HC4_2 Prok-RING_4 zf-C3HC4_4 zf-C3HC4_3 Zn_ribbon_17 zf-RING_5 PHD E3_UbLigase_EDD RINGv Endonuclease_7 FANCL_C zf-HC5HC2H
Motif
Other DBs
NCBI-GeneID: 113284311
NCBI-ProteinID: XP_026389533
Position
5
AA seq 589 aa AA seqDB search
MGISYISVSVVCAVGSFLGLQWWTLSLLDKFKLDGLIAENYIHSENANHALDLLLGSNVI
IALLVNFVINLYVLLILCLKAIFFVQLHATETRKVVERCVNYIIYKGAFLPLIVPPTVSQ
AALWSTWLTVLCTLKMFQALGRDRLEWLNASPSATPWTYFRVFSVLLLVLSADVFWLRLC
IIIYRSLGSTMFLLLFFEPLSIAFETVQAVMVHGFQLLDMWQRHSVESNTDCQSSQLFSR
SVAGSLLEWKGLLVRNCGFVLDIMTWLMALGHYLHIWWLHGMAFHLIDAVIFLNIRALLS
AVIKRIKGFVKLRVALSSLHGALPDATSEELQAYDDECAICREPMAKAKKLSCNHLFHLA
CLRSWLDQGTNEVYSCPTCRRSLFPGARENSTHSRTEEALNNEHLARQIGYGSDTQNAPD
RVPPAGTFPNQPQAPPDGIPWRVGLESNWGQPWPNQGSDGAGPSSTAVRSVGLGRVQMMM
RHLASVGETYAQTAIEDAAWGLWPTPHPQAASGSSVLPPQAAAALGYNGHIGGLRIRNPT
HSVNDNMSAILAMAETVREVLPHIPNEIIFQDLQRTNSVAVTVNNLLQM
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgggtattagttacatatctgtttcagtggtgtgtgcagttgggagtttcttagggcta
cagtggtggacactatctttactagacaagttcaaattagatggtttaattgctgagaat
tatatacattctgagaatgctaatcatgcacttgacttactattgggatccaatgttata
attgcactgttggtgaattttgtgatcaatctatacgttctgctcattttgtgtctcaag
gctattttttttgtccagctgcatgcaactgagacgcgaaaagtagtggaacgatgtgta
aattacattatatacaagggggcgtttcttcctttgattgtaccacccactgtttcccaa
gcagcattatggtcaacttggttgacagttctctgtaccttgaagatgtttcaggcattg
ggtagagaccggctggaatggctgaatgcatctccttctgcaacaccatggacatacttt
cgcgtcttttctgttctgctgctggttctatccgctgatgtcttctggttaagactttgt
atcataatatatagatcactgggttcaactatgtttttgctgttattctttgaacctctc
agtattgcttttgagactgtacaggcggtgatggtgcacggatttcagctccttgatatg
tggcaacgacattcagtagaaagcaacacagattgccaaagctcccagctctttagcaga
tcggtggcaggttctttattggaatggaagggccttcttgttcggaactgtggttttgtc
ctagacataatgacctggttgatggctctcggtcattacttgcatatctggtggcttcac
ggcatggcgttccatctaattgatgcagtcattttcctaaacatacgcgctctgctaagt
gcagttataaagaggatcaaaggatttgttaagctgagagtagctcttagttctcttcat
ggggcacttcctgatgcgacatctgaagagttgcaagcatatgatgatgaatgtgccatt
tgcagggaaccaatggcgaaggcgaaaaaactatcctgtaatcatcttttccatcttgca
tgcctgagatcatggttagatcagggtacgaacgaggtttattcatgtcctacatgtcga
aggtcgctatttccaggcgcacgtgaaaacagtactcactcccgtactgaggaagccttg
aataatgaacatcttgcccgtcaaataggttatggatcggacacacaaaatgcaccagac
cgtgtcccgcctgcaggaacatttcctaaccaaccacaggctcctcctgatggtatcccg
tggagagttgggttggaatcaaattggggacaaccttggccaaaccagggttccgatggt
gctggtccatcaagtactgcagtgagatcagttgggttaggcagagttcagatgatgatg
agacatttagcatctgtgggtgaaacctatgcccagactgccattgaagatgctgcatgg
ggtctttggcctacgccacatccccaggctgcgtctggctcttctgttcttcctccccaa
gctgctgctgctttaggctataatggacatattggtggtttacgcatcaggaatcccact
cattctgtgaatgataacatgtcagctatacttgccatggcggagactgtcagggaagtg
cttccccatattcccaatgaaataatttttcaggacttacagcgtacaaactctgtcgct
gtcactgtaaataatctacttcaaatgtga

KEGG   Papaver somniferum (opium poppy): 113355490Help
Entry
113355490         CDS       T05758                                 

Definition
(RefSeq) E3 ubiquitin protein ligase RIN2-like
  KO
K10636  autocrine motility factor receptor [EC:2.3.2.27]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113355490
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:psom04121]
    113355490
Enzymes [BR:psom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     113355490
Ubiquitin system [BR:psom04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    113355490
  Multi subunit Ring-finger type E3
   ERAD complex
    113355490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-RING_2 CUE zf-C3HC4 zf-rbx1 zf-RING_UBOX zf-RING_11 zf-ANAPC11 zf-C3HC4_2 Prok-RING_4 zf-C3HC4_4 zf-C3HC4_3 Zn_ribbon_17 zf-RING_5 PHD E3_UbLigase_EDD RINGv Endonuclease_7 FANCL_C zf-HC5HC2H
Motif
Other DBs
NCBI-GeneID: 113355490
NCBI-ProteinID: XP_026454145
Position
3
AA seq 589 aa AA seqDB search
MGISYISVSVVCTVGSFLGLQWWTLSLLDKFKLDGLIADNYIHSENANHALDLLLGSNLI
VALLVNFVINLYVLLILCLKAIFFVQLHPTETRKVVERCVNYIIYKGAFLPLIVPPTVSQ
AALWSTWLTVLCTLKMFQALGRDRLERLNASPSATPWTYFRVFSVLLLVLSADVFWLRLC
IIIYRSLGSTMFLLLFFEPLSIAFETVQAVMVHGFQLLDMWQRRSVESNTDCQSSQLFSR
SVAGSLLEWKGLLVRNCGFFLDIMTWLMALGHYLHIWWLHGMAFHLIDAVIFLNIRALLS
AVIKRIKGFVKLRLALSSLHGALPDATSEELQAYDDECAICREPMAKAKKLSCNHLFHLA
CLRSWLDQGTNEVYSCPTCRRSLFPGARENSTHSRTEEALNNEHLARQIGYGLDTQNAPD
RVPPAGTFPNQPQAPPDGIPWRVGLEPNWGQPWPDQGSDGAGPSSTAVRSVGLGRVQMMM
RHLASVGETYAQTAIEDAAWGLWPTPHPQAASGSSVLPPQAAAALGYNGHIGGLRFRNPT
HSVNDNMSAILAMAETVREVLPHIPNEIIFQDLQRTNSVAVTVNNLLQM
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgggtattagttacatatctgtttcagtggtgtgtacagttgggagtttcttagggcta
cagtggtggacactatctttactagacaagttcaaattagatggtttaattgctgataat
tatatacattctgagaatgctaatcatgcacttgacttactattgggatccaatcttata
gttgcactgttggtgaattttgtgatcaatctatacgttctactcattttgtgtctcaag
gctattttttttgtccagctgcatccaactgagacgcgaaaagtagtggaacgatgtgta
aattacattatatacaagggggcatttcttcctttgattgtaccacccactgtttcccaa
gcagcattatggtcaacttggttgacagttctctgtaccttgaagatgtttcaggcattg
ggtagagaccggctggaacggctgaatgcatctccttctgcaacgccatggacatacttc
cgcgtcttttctgttctgctgctagttctatccgctgatgtcttctggttaagactctgt
atcataatatatagatcactgggttcaactatgtttttgctgttattctttgaacctctc
agtattgcttttgagactgtacaggcggtgatggtgcacgggtttcagctccttgatatg
tggcaacgacgttcagtagaaagcaacacagattgccaaagctcccagctctttagcaga
tcggtggcaggttctttattggaatggaagggccttcttgttcggaactgtgggtttttt
ctggacataatgacctggttgatggctctcggtcattacttgcatatctggtggcttcat
ggcatggcgttccatctaattgatgcagtcattttcctaaacatacgcgctctactaagt
gcagttataaagaggatcaaaggatttgttaagctgagattagctcttagttctcttcat
ggggcacttcctgatgcgacatctgaagagttgcaagcatatgatgatgaatgtgccatt
tgcagggaaccaatggcgaaggcgaaaaaactatcctgtaatcatcttttccatcttgca
tgcctgagatcatggttagatcagggtacgaacgaggtttattcatgtcctacatgtcga
agatcactatttccaggtgcacgtgaaaacagtactcactcccgtactgaggaagctttg
aataatgaacatcttgcccgtcaaataggttatggattggacacacaaaatgcaccagat
cgtgtcccgcctgcaggaacatttcctaaccaaccacaggctcctcctgatggtatcccg
tggagagtggggttggaaccaaattggggacaaccttggccagaccagggttccgatggt
gctggtccatcaagtactgcagtgagatcagttgggttaggcagagtccagatgatgatg
agacatttagcatctgtgggtgaaacctatgcgcagactgccattgaagatgctgcatgg
ggtctttggcctacgccacatccccaggctgcgtctggctcttctgttcttcctccccaa
gctgctgctgctttaggctataatggacatattggtggtttacgcttcaggaatcccact
cattctgtgaatgataacatgtcagctatacttgccatggcggagactgtcagggaagtg
cttccccatattcccaatgaaataatttttcaggacttacagcgtacaaactctgttgct
gtcactgtaaataatctacttcaaatgtga

DBGET integrated database retrieval system