KEGG   Papaver somniferum (opium poppy): 113286188Help
Entry
113286188         CDS       T05758                                 

Definition
(RefSeq) putative wall-associated receptor kinase-like 16
Organism
psom  Papaver somniferum (opium poppy)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase GUB_WAK_bind EGF_CA EGF PIP49_C FXa_inhibition EGF_3 cEGF
Motif
Other DBs
NCBI-GeneID: 113286188
NCBI-ProteinID: XP_026390663
Position
1
AA seq 753 aa AA seqDB search
MLLQLFLYFLLLSWLTLLKETASLEGPFFKAKTGCDAKCGNVSIPYPFGIRQNGINVGCS
FNGVGFDYSITCNTSFNPPKPFLDVGDVEVIDISETEIRTKNTPATLCHNASGGVTLNLP
SSSISLDRTPFTLSYTKNMYFTVGCNVFSIIQGPDLQNYTGTCTSTCETKESVISGSCVS
NNGCCESTIPKGLKKIEITMAKNRQQSNVSWYFDPCNYAFVGQYTFQSTDVLDGYNFVSK
GKEVPVVFDWAIGNKTCEEAQKDLSTFACQANSHCINPDNNPGYLCICNEGYGGNPYLSP
GCQDVNECDDQSTNLCVENCTNTIGSYICSCPKGSRGDGRKDGTGCLIQDNQNAPVLQIS
LGIGLGFLFLVLSGFWLYLSMKKRNSIKLKKKCFQKNGGLLLKQQIHENGGAQSSAKIFT
AEELQLATKNYDAKLVLGRGGHGIVYKGTLADTRAVAIKKPIIVKESHIEEFINELVILT
QVNHRNVVKILGCCLETEVPLIVYEYVSNGTLSEHIHSKNGVSSSSLSWESRLRIAAETA
GALSYLHSATTVPIIHRDIKSANVLLDENYTAKVADFGASRLNPLDLAEIDTIVQGTLGY
LDPEYYESGQLTGKSDVYSFGVVLVELLTGERPISLARTKRKQNFALYFHSLVTENDVLE
VLEARVATEGKREQVLAVAMLAKRCLNLKGGDRPTMKQVAVELESLSKFVSLNHTSKHFS
EEHTNIKPDPIDLYPPIQLDSYVDGDSSLYSNI
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgcttctgcaacttttcttgtactttctgctgctttcatggctaactcttctaaaagaa
acagcatcactagagggtccattcttcaaggcaaaaactggctgtgatgccaaatgcggt
aatgtttcgattccttatccatttggaatacgtcaaaatgggattaatgttgggtgctct
tttaatggagttgggtttgattacagcattacctgcaatacttcttttaatcctcctaaa
cccttcctagatgtaggtgacgttgaagtcatagatatttcagaaaccgaaattcgaaca
aaaaacaccccagcaacattatgtcacaacgcatctggtggggtaaccttaaatctacct
tcttctagtatatccttagatcggactccatttacattatcctatacaaagaacatgtac
tttacagtcggctgcaatgtgttctccatcatccaaggtcctgatttacaaaactacaca
ggaacatgtacttcaacctgtgagactaaagaaagtgtgataagtggatcttgcgtgagc
aacaacggttgttgcgaaagtactatacccaaagggcttaagaaaattgaaataacgatg
gcaaagaaccgtcagcagtcaaatgtcagttggtattttgatccttgtaattatgcattc
gtaggtcagtatacattccaatcaacggatgttttggatggttataattttgttagcaaa
gggaaagaagtccccgtggtttttgactgggcaatagggaacaagacttgtgaagaagca
caaaaagacttatccacctttgcatgccaagcaaatagtcattgtatcaatccagataac
aatcctggatatctttgcatttgcaatgaaggttatggcggaaatccttacctcagtcct
ggatgccaagatgtgaacgagtgcgatgatcaaagcactaatctctgtgtggagaattgc
acaaataccattgggagttacatttgttcttgtccaaaggggagtcgtggcgatggaaga
aaagatgggactggttgccttattcaagacaaccaaaatgctccggtgttgcagatatct
ctcggaattggtttaggcttcttgtttctagttctctcaggtttctggttatacttgagt
atgaagaaaagaaactcaatcaaactcaaaaagaaatgttttcaaaagaatggtggtttg
ttgttaaaacaacaaatacatgaaaatggtggtgctcaatcatcggcaaaaatctttaca
gctgaagagctacaattggcaaccaaaaattatgatgcaaaattagtgttaggccgcgga
ggccatggtatagtttacaagggaactttagctgacacccgagcagtggcaattaaaaaa
ccaataatagtgaaggagagtcacatagaagaattcattaatgagcttgttatcttaact
caagttaaccatcgaaacgttgtgaagatcttgggatgttgcttagagactgaagtcccc
ttgattgtttatgaatacgtttctaatggcactctctccgaacatatccattccaagaat
ggggtatcctcatcatcactctcttgggaaagtcggttaaggattgctgccgaaactgct
ggtgcactttcttatttacactctgctactactgtacccatcatccatagagatatcaaa
tctgccaatgttctattagatgaaaactacactgcgaaagttgcggatttcggagcatcg
aggttgaatcctttggatttagctgaaatagacacaattgtccaagggacattgggttat
cttgatccagaatactatgagtctggccagttgacaggtaaaagcgatgtttatagtttt
ggtgttgttctggtagaacttttaacaggagaaaggcctatttctttggccaggacaaaa
agaaaacaaaattttgctttgtatttccattccttggttacagagaatgatgtgctagaa
gttcttgaggctcgagtggctactgaagggaaacgagaacaagttcttgcagttgctatg
cttgcaaagagatgccttaatttgaaaggtggagataggcctacaatgaaacaagtcgct
gtggaacttgagagtttatcaaaatttgtatcactaaatcacacatctaagcacttctct
gaagaacacactaacataaaaccggatccgatagacttgtatcctcctatccagttagac
tcctatgttgatggcgattctagcttgtatagtaatatatga

DBGET integrated database retrieval system