KEGG   Papaver somniferum (opium poppy): 113287496Help
Entry
113287496         CDS       T05758                                 

Definition
(RefSeq) pyruvate decarboxylase 1-like
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00010  Glycolysis / Gluconeogenesis
psom01100  Metabolic pathways
psom01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    113287496
Enzymes [BR:psom01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     113287496
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C NIBRIN_BRCT_II
Motif
Other DBs
NCBI-GeneID: 113287496
NCBI-ProteinID: XP_026392057
Position
6
AA seq 589 aa AA seqDB search
MGSHIELGTSLHPCSNSSPLHPIASNSATLGRHLARRLVQVGVKDVFSVPGDFNLCLLDH
LIAEPELSLVGCCNELNAGYAADGYARAKGVGACVVTFTVGGLSVINAIAGAYSEDLPVI
CIVGGPNSNDYGTNRILHHTIGLPDFSQELRCLQTVTCFQAVVNNLDDAHELIDTAISTA
LKESKAVYISISCNLPAVPHPTFTEEPVPFYLAPRLQSNGLEAAVEATAEFLNKAVKPVI
VGGPRLRVCKAQQAFVELADASGYAISVMPSGKGLIPEHHRHFIGTYWGAVSSSFCGEIV
ESADAYVFVGPMFNDYSSVGYSLLIKKENAVIVQPNRVTVGNGPSFGCVYMADFLTALAS
KLKKNTTAMENYQRIFVPHGIPLKREINEPLRVNILFKHIQEMLSGDTAVIAETGDSWFN
CQKLHLPENCGYEFQMQYGSIGWSVGATLGYSQAAKHKRVIACIGDGSFQVTAQDVSTMI
RCGQKTIIFLINNGGYTIEVEIHDGPYNVIKNWSYTKFVDAIHNGEGKCWTTKVTTEEEL
IEAISKATGEEKDSFCFIEVLVHKDDTSKELLEWGSRVSAANSRPPNPQ
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgggttcccatattgaacttggaacttctctacatccttgttcaaactcatcaccctta
catccaattgcttcaaattctgcaacacttggtagacatttagcacgtcgtctagttcaa
gttggtgtaaaagatgtattctcagtacctggtgattttaacctatgtttgttagatcac
ttaatagctgaaccagaacttagtttagttggttgttgtaatgaacttaatgctggttat
gctgctgatggttatgcaagagcaaaaggtgttggtgcttgtgttgttacctttactgtt
ggcggacttagtgttattaatgctattgctggtgcttatagtgaggatctacctgtgata
tgcattgtcggtggtcctaattctaatgattatggtactaatcgtattcttcatcatact
attggattacctgattttagtcaagaactgcgatgcttacagactgttacttgtttccag
gctgtggttaacaacttggatgatgcacatgagctaattgacactgctatctcaactgct
ttgaaggaaagcaaggcagtttatatcagtattagctgtaatttgcctgcagttcctcac
ccaacttttactgaagagcctgtgccgttctatcttgcaccaaggttgcaatcaaatggg
ctagaggctgcagtggaggctacagccgagtttttaaacaaggctgtaaaacctgtaatt
gttggtgggcctaggttaagggtgtgtaaggctcagcaagcatttgttgagctagcagat
gctagcgggtatgccatatctgtcatgccatctggcaaaggtctgatacctgaacatcac
cgtcactttattggaacgtattggggtgctgtcagttccagcttctgcggggaaattgtg
gagtcagctgatgcttatgtttttgttggccccatgtttaatgactacagttctgtgggg
tactcgttgcttatcaagaaggagaatgctgtaattgtacagcctaaccgggttaccgtt
ggcaacggtccttcttttggctgtgtgtatatggcagacttcttgactgctttggcctcg
aaactgaagaagaacactacagctatggaaaattatcaacgaatctttgttccacatggt
atccctttgaagcgtgaaataaatgaacctttgagagtaaacatcctattcaagcatatt
caggaaatgctgagtggagacacggcagttattgcggaaacaggggattcatggttcaac
tgtcagaaattacatctcccagaaaattgcggatatgaattccagatgcagtatggatcc
atcggatggtcagtaggtgccactcttggatattctcaggctgcaaaacataagcgtgtc
attgcctgtattggtgatggaagtttccaggttacagctcaggacgtctccacgatgatc
cgctgtggccagaagactatcatattcctcattaacaatggaggatacacaattgaagtt
gaaatccatgacgggccatataatgtgattaagaactggagctacaccaagtttgttgac
gctatccataatggtgaaggaaaatgttggaccaccaaggtgacaacagaggaggagctg
atcgaagcaatctcaaaagcaacaggagaagagaaggatagcttctgcttcatagaggtc
ttggtgcacaaggatgatacgagcaaagaactgttggaatggggatcaagggtttctgct
gccaatagtcgcccaccaaatcctcagtaa

DBGET integrated database retrieval system