KEGG   Papaver somniferum (opium poppy): 113287756Help
Entry
113287756         CDS       T05758                                 

Definition
(RefSeq) external alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial-like
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
psom  Papaver somniferum (opium poppy)
Brite
KEGG Orthology (KO) [BR:psom00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    113287756
Enzymes [BR:psom01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     113287756
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox EF-hand_1 EF-hand_6 EF-hand_5 DAO NAD_binding_7 EF-hand_7 EF-hand_8 Lipoprotein_3 p25-alpha LysR_substrate
Motif
Other DBs
NCBI-GeneID: 113287756
NCBI-ProteinID: XP_026392376
Position
6
AA seq 583 aa AA seqDB search
MRILSFYERASRAFKDYPSLSKILVVATVGGGGLVAYSDAKPHNAVNVVESSPTAANKKR
VVVLGTGWAGTSFLKNLDSATYDVHVISPRNYFAFTPLLPSVTCGTVEARSVVEPIRNII
RKKDGDYSFWEAECFKIDGKNKKVHCRPVQRESPEGKEEFIVDYDYLVVAMGARSNTFNT
PGVEENCHFLKEVEDAQKIRRNVIDCFEKSCLPNLSEDERKKHLHFVVVGGGPTGVEFSA
ALHDFISEDLVKLYPTAKDLVKITLLEAGDHILTMFDKRITAFAEEKFQRDGINLKTGSM
VVKVTDKDICTKDRGTGEISSIPYGMVVWSTGIGTRPVVTDFMKQIGQSNRRVLATDEWL
RVEGCDSIYALGDCATINQRKVMEDISAIFNKADKDQSGTLTTKEFQDALDDICERYPQV
ELYLKDKQVKNIVDLLKDSKGNDKKETLEMVIEGFKSALSQVDSKVKFLPATAQVAAQQG
KYLARCFNEMEERTKNPEGPPRFRGVGRHRFHPFRYRHLGQFAPLGGEQTAAQLPGDWVS
IGHSSQWIWYSVYASKQVSWRTRMLVVSDWGRRFIFGRDSSGI
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgaggattttatcgttctacgaacgagcttctcgtgcttttaaagattatccttctcta
tctaaaatccttgttgttgccaccgtcggaggtgggggtcttgtggcatattctgatgcg
aaaccacacaatgctgtcaatgtggtcgaatcttctccaacggccgccaataaaaagagg
gttgtggtgcttggcactgggtgggctggcacaagtttcttgaagaatttggatagtgca
acatatgatgttcatgtgatttcacctcgtaactattttgcatttactccattattacca
agtgtcacatgtgggacagtcgaagcacgtagtgttgttgaaccaatacgcaacatcatt
aggaagaaagatggagactatagcttttgggaagctgaatgtttcaagattgatggaaag
aataagaaagttcattgcaggcctgttcagcgtgagtctcctgaagggaaagaggaattt
atcgttgattatgactacttggtggtcgccatgggagcccgatcaaatacgttcaacaca
cctggtgttgaggagaattgtcatttcttaaaggaagtcgaggatgctcaaaaaatccgc
aggaatgtgattgactgttttgagaagtcctgcctcccaaatctaagtgaggatgaaaga
aagaagcatcttcattttgtagttgttggtggtggtccaacaggagtggagttttcagca
gcactgcacgattttatcagcgaagatttggtcaagctatatcctaccgccaaagaccta
gttaaaataactctccttgaggcaggagatcatattctgaccatgtttgacaaaagaata
actgcttttgctgaagagaagtttcagagagatggtattaacttgaaaacagggtcaatg
gtcgtcaaggtaactgacaaggacatctgtacaaaggacagaggaaccggagaaatctct
tctataccatatggaatggttgtctggtcaactggtatcgggacccgtcctgttgttacg
gactttatgaagcaaattggtcagtctaataggcgtgttttggccactgatgaatggctt
cgagttgaaggatgtgatagcatatatgcacttggtgattgtgccaccattaatcaacgc
aaagtcatggaggacatttctgcaattttcaacaaggcagataaagaccaatcaggtact
cttacaacaaaagaattccaagatgctctggatgatatctgtgagaggtacccacaagtg
gagctttacttgaaggataagcaagtgaaaaacatagtggatcttttgaaggattccaag
ggaaatgataaaaaagaaacacttgaaatggttatagaagggttcaagtcagctctttcc
caagtggattcaaaagtgaagttccttcctgcaacagctcaggtagctgctcaacaagga
aaatatcttgcaaggtgtttcaatgagatggaagagcgtacgaagaatccagaaggtcct
ccgaggttcaggggagttgggcgtcatcgattccatccctttaggtataggcatcttggg
cagtttgctccattgggaggagagcaaacagcagcacaacttcctggtgattgggtttcc
attggtcacagttcacagtggatctggtactctgtttatgccagcaaacaagtcagttgg
cgtacaaggatgttggtggtgtctgattggggcaggcgattcatttttggaagagactcc
agcggtatctaa

DBGET integrated database retrieval system