KEGG   Papaver somniferum (opium poppy): 113290852Help
Entry
113290852         CDS       T05758                                 

Definition
(RefSeq) cysteine-rich receptor-like protein kinase 10
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
psom  Papaver somniferum (opium poppy)
Brite
KEGG Orthology (KO) [BR:psom00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:psom01001]
    113290852
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Stress-antifung Pkinase_fungal Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 113290852
NCBI-ProteinID: XP_026396245
Position
1
AA seq 476 aa AA seqDB search
MNYTANSTYQTNLNLLLSSLATTFTDTNTISRYRYRNITIGRNPNTVYGSLHCREDIAPA
ICAVCVQIAAERVTQDSGCPSKKTAILFYNGFILRYSDENYFSILNEEPSVVLVFVDNSI
ANQVGYIDLVTGLPDDLVIEAVTNTSISPSLYATGSANYNTSNQVYAMVQCTPDLAPTLC
SKCLRSALGKLPSGAQGASIQLEKQSSCKPRVYYPMEKQSLSKDFLKTQAKEKLLVYELM
DASLDHFIFDTVKRMHLDWEKRYKIIGGIAKGLLYLHEDSRLRIIHRDLKASNILLAENM
IPKISDFGMARLFKVDQSQANTSRVAGTIGYMAPEYMRHGQFSVKSDVYSFVVLVLEILS
GKKITCRYVLATGGAQDLLTYTWRHWHKGTALELLDSSFKDRCSRTEAMKCIHIALLCVQ
DSIVDRPTMSTVILMLSSNSMTFPLPTQPANFVPDQAVAEETWKDNEASVSELDPR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaattacacagccaacagtacatatcaaaccaatctcaatctcttactctcatctctg
gcaactacattcacagacaccaacactatctctcggtatcgttaccgtaacattacaatc
ggaagaaatccaaatactgtttatggatccttacactgccgtgaagatattgcaccggct
atatgtgcagtatgtgttcagattgctgctgaaagggttacgcaagattccgggtgtcca
agtaaaaaaacagccattcttttctacaacggatttattttaaggtattcagatgagaat
tacttctccatcttgaatgaagaaccatccgttgtcttagtgtttgtggataatagtatt
gcaaaccaagtcgggtacatagacttagtaactggactaccggatgatttagttattgaa
gctgttactaatacttctattagtccttctttatacgctactggttcagcaaattacaat
acatctaaccaagtttatgcaatggttcagtgtacaccagacttggcaccaactctctgt
agtaaatgtcttagatcagctcttgggaaattaccttctggtgcccaaggggcaagtata
caactcgagaagcagtcgagttgcaaaccaagggtatattacccaatggagaagcagtcg
ctgtcaaaagactttctaaaaactcaagccaaggagaaactactcgtgtacgagttaatg
gatgcaagtctagaccatttcatattcgatactgtgaaacgaatgcatttagattgggaa
aaacgatacaagattattggaggaattgctaaaggtcttctttatcttcatgaggattct
cggctcaggataattcatcgagatctcaaagctagcaacatattattagccgaaaatatg
attccaaaaatttcagattttggaatggctaggctttttaaggtggatcaaagtcaagct
aatacaagcagagttgcaggaacaattgggtatatggctccagaatatatgcgacatgga
caattttctgtaaaatcagacgtttatagtttcgttgtcctagttctcgagattcttagc
ggaaaaaagatcacatgtcgttatgtactggccacaggaggcgctcaagatcttctgact
tatacatggaggcattggcataaaggaacagctttagaactgttagattcaagtttcaaa
gatcgttgttcaagaaccgaagcaatgaaatgtatccacattgcccttttatgtgttcaa
gacagcattgttgatagacctaccatgtccacggtcatcttaatgcttagcagcaactcc
atgactttcccattacctacacaacctgcaaattttgtgcccgaccaagcagtggcagag
gagacatggaaagacaatgaggcatccgtttctgaattggatcctcgttaa

DBGET integrated database retrieval system