KEGG   Papaver somniferum (opium poppy): 113293025Help
Entry
113293025         CDS       T05758                                 

Definition
(RefSeq) serine/threonine-protein kinase PCRK1-like
Organism
psom  Papaver somniferum (opium poppy)
Brite
Enzymes [BR:psom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113293025
Protein kinases [BR:psom01001]
 Serine/threonine kinases: TKL group
  IRAK family
   113293025
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase APH
Motif
Other DBs
NCBI-GeneID: 113293025
NCBI-ProteinID: XP_026397591
Position
7
AA seq 443 aa AA seqDB search
MRCFQSDNGEKRNDLITTATTRSSMPHLSSSASTSTDDFRRLDSAFGSQNVSDMSAGSSS
KTPSRKHLRCPTQKSNNLRVFTLSELKTATKNFNQLLMIGEGGFGCVYRARINSSEDSRA
KIDVAIKQLGKRGLQGHKEWVTEVNVLGVVDHKNLVKLVGYCNEDDERGIQRILVYEFMK
NRSVEDHLTNKSTKALSWAMRIKIAEDAACGLAYLHEEMDFQIIFRDFKSSNILLDDQWN
AKLSDFGLAREGPTEGASHVSTAIVGTLGYAAPEYIQTGRLTTKNDVYSYGVFLYELITG
RRPLDRNRPRGEQNLIEWVRPYLTDIKKFEQILDPRLEGKYNLRSAMKLAAVANRCMSRQ
PRVRPKMSEVLEKVKLIVEGKEIIGSTPNEVPPLPQKSFDPNDPSVEGEHNPNSPTSKTS
LSTITDSCLSCMKFWSPKIVQVS
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaggtgttttcaatccgataatggggagaagagaaatgacctgataactactgctact
acaaggtcatcaatgcctcatttatcctctagtgcttctacgtcgaccgatgattttcgg
agacttgattctgcatttggatctcagaatgtatcagacatgagtgcggggtcatcaagc
aaaaccccaagccgaaaacatttacggtgtccaacacaaaaatctaacaatcttagagtg
ttcacattatccgagctcaagactgcaacaaagaatttcaaccagcttcttatgattggt
gagggtgggttcgggtgtgtttacagggcgcggataaatagctcggaggattcacgtgct
aagatcgatgttgctattaaacagcttggcaaaagaggattacaggggcacaaggaatgg
gttacagaagtaaatgtacttggagtagttgaccataaaaaccttgtaaaattagtgggt
tattgtaacgaggacgatgaaagaggaattcagcggattctggtatatgaatttatgaaa
aatagaagtgtggaagaccatttaacgaataaaagcacaaaagctctttcatgggccatg
agaattaaaatagcagaagatgctgcttgtgggttggcttacttgcacgaagaaatggat
tttcagattatctttagagattttaaatcttcaaacattctcttggatgatcaatggaat
gctaagctatcggattttgggttggccagggaaggcccgacagaaggagctagtcatgta
tcaacagcgattgtgggcactcttgggtatgcagctcctgaatatatacaaactggtcgt
ctcacaaccaagaacgacgtttacagctatggggttttcctatacgaactcataactggt
aggcgcccactagatcgaaaccgcccaaggggagagcagaacctcatagaatgggtgagg
ccttacttaacagacattaagaaatttgagcagatattagacccaaggctggaagggaag
tacaatttgagaagtgccatgaagctagcagccgtggctaaccggtgcatgtcccgacaa
ccaagggtgcgcccgaagatgagtgaggttctggagaaagtgaagctgatcgtggaaggg
aaggaaataattggctctacccctaatgaggtaccaccgttgccacagaagagctttgat
cccaatgatccttccgtagaaggtgagcataatccgaattcgcccacttcaaagacgtca
ctttccacaattacagatagttgtttgtcatgtatgaaattctggtccccgaagattgtt
caggttagctga

DBGET integrated database retrieval system