KEGG   Papaver somniferum (opium poppy): 113293923Help
Entry
113293923         CDS       T05758                                 

Definition
(RefSeq) RING-box protein 1a
  KO
K03868  RING-box protein 1 [EC:2.3.2.32]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom03420  Nucleotide excision repair
psom04120  Ubiquitin mediated proteolysis
psom04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113293923
   04120 Ubiquitin mediated proteolysis
    113293923
  09124 Replication and repair
   03420 Nucleotide excision repair
    113293923
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:psom04121]
    113293923
   03400 DNA repair and recombination proteins [BR:psom03400]
    113293923
Enzymes [BR:psom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     113293923
Ubiquitin system [BR:psom04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   113293923
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     113293923
   ECV complex
     113293923
   Cul3 complex
     113293923
   Cul4 complex
     113293923
   Cul7 complex
     113293923
   Cul9 complex
     113293923
DNA repair and recombination proteins [BR:psom03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      113293923
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      113293923
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 Zn_ribbon_17
Motif
Other DBs
NCBI-GeneID: 113293923
NCBI-ProteinID: XP_026398151
Position
7
AA seq 126 aa AA seqDB search
MAATLDTDVNMIPAGETPSTAVAGSSSCCSSNKNDKPKRFEIKKWNAVALWAWDIVVDNC
AICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWE
FQKYGH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaactctagatacagatgtgaacatgataccagctggtgaaacaccatcaaca
gctgttgctggttcttcttcatgttgttcttcaaataaaaacgacaaacctaaaagattt
gagatcaagaagtggaacgctgttgctctttgggcttgggatattgtggtggataattgt
gcgatttgcaggaatcacattatggatctatgtattgaatgtcaagcaaatcaggcaagt
gcgactagtgaggagtgtactgtcgcttggggggtttgcaaccatgccttccacttccac
tgcatcagtcgttggctcaagactcgtcaagtttgtccattggataacagcgagtgggaa
ttccagaagtacggtcactag

KEGG   Papaver somniferum (opium poppy): 113326900Help
Entry
113326900         CDS       T05758                                 

Definition
(RefSeq) RING-box protein 1-like
  KO
K03868  RING-box protein 1 [EC:2.3.2.32]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom03420  Nucleotide excision repair
psom04120  Ubiquitin mediated proteolysis
psom04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113326900
   04120 Ubiquitin mediated proteolysis
    113326900
  09124 Replication and repair
   03420 Nucleotide excision repair
    113326900
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:psom04121]
    113326900
   03400 DNA repair and recombination proteins [BR:psom03400]
    113326900
Enzymes [BR:psom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     113326900
Ubiquitin system [BR:psom04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   113326900
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     113326900
   ECV complex
     113326900
   Cul3 complex
     113326900
   Cul4 complex
     113326900
   Cul7 complex
     113326900
   Cul9 complex
     113326900
DNA repair and recombination proteins [BR:psom03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      113326900
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      113326900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4
Motif
Other DBs
NCBI-GeneID: 113326900
NCBI-ProteinID: XP_026430350
Position
Unknown
AA seq 124 aa AA seqDB search
MASLDSDINMEDSSAAAAPPCQHPSSSSSALPKKPKRFEIKKWNAVALWAWDIVVDNCAI
CRNHIMDLCIECQANQASNTSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQ
KYGH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggcttctctagatagtgatattaacatggaggattccagcgccgccgcagcgccaccg
tgccaacatccatcttcatcatcatcagctcttccaaagaaacctaagagatttgaaatc
aagaagtggaatgctgtcgccttatgggcttgggatattgttgtggataactgtgctatt
tgcaggaatcatatcatggatctctgtattgagtgtcaagctaatcaagctagtaataca
agtgaggaatgcactgttgcttggggtgtatgcaaccacgcattccatttccattgcatc
agtcgttggctaaagacccgtcaagtgtgcccactggacaacagtgagtgggaatttcag
aagtatggccactag

KEGG   Papaver somniferum (opium poppy): 113327705Help
Entry
113327705         CDS       T05758                                 

Definition
(RefSeq) RING-box protein 1a-like
  KO
K03868  RING-box protein 1 [EC:2.3.2.32]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom03420  Nucleotide excision repair
psom04120  Ubiquitin mediated proteolysis
psom04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113327705
   04120 Ubiquitin mediated proteolysis
    113327705
  09124 Replication and repair
   03420 Nucleotide excision repair
    113327705
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:psom04121]
    113327705
   03400 DNA repair and recombination proteins [BR:psom03400]
    113327705
Enzymes [BR:psom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     113327705
Ubiquitin system [BR:psom04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   113327705
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     113327705
   ECV complex
     113327705
   Cul3 complex
     113327705
   Cul4 complex
     113327705
   Cul7 complex
     113327705
   Cul9 complex
     113327705
DNA repair and recombination proteins [BR:psom03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      113327705
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      113327705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 Zn_ribbon_17
Motif
Other DBs
NCBI-GeneID: 113327705
NCBI-ProteinID: XP_026430632
Position
Unknown
AA seq 126 aa AA seqDB search
MAATLDTDVNMIPGGETPSTAVAGPSSCCSSKQNNKPKRFEIKKWNAVALWAWDIVVDNC
AICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWE
FQKYGH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggcagctaccttagatacagatgtgaacatgataccaggaggtgaaacaccatcaaca
gctgttgctggtccttcttcgtgttgttcttcgaagcaaaacaacaaacctaaaagattt
gagatcaagaagtggaacgctgtcgctctttgggcttgggatattgtggtggataattgt
gcgatttgcaggaatcacattatggatctatgtattgaatgtcaagcaaatcaagcaagt
gcgaccagtgaggagtgtactgtcgcttggggggtttgtaaccatgccttccacttccac
tgcatcagtcgttggctcaagactcgccaagtttgtccattggataacagtgagtgggaa
ttccagaagtacggtcactag

KEGG   Papaver somniferum (opium poppy): 113339765Help
Entry
113339765         CDS       T05758                                 

Definition
(RefSeq) RING-box protein 1-like
  KO
K03868  RING-box protein 1 [EC:2.3.2.32]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom03420  Nucleotide excision repair
psom04120  Ubiquitin mediated proteolysis
psom04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113339765
   04120 Ubiquitin mediated proteolysis
    113339765
  09124 Replication and repair
   03420 Nucleotide excision repair
    113339765
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:psom04121]
    113339765
   03400 DNA repair and recombination proteins [BR:psom03400]
    113339765
Enzymes [BR:psom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     113339765
Ubiquitin system [BR:psom04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   113339765
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     113339765
   ECV complex
     113339765
   Cul3 complex
     113339765
   Cul4 complex
     113339765
   Cul7 complex
     113339765
   Cul9 complex
     113339765
DNA repair and recombination proteins [BR:psom03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      113339765
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      113339765
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4
Motif
Other DBs
NCBI-GeneID: 113339765
NCBI-ProteinID: XP_026440774
Position
Unknown
AA seq 124 aa AA seqDB search
MASLDSDINMEDSSAAAAPPCQHPSSSSSALSKRPKRFEIKKWNAVALWAWDIVVDNCAI
CRNHIMDLCIECQANQASNTSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQ
KYGH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggcttctctagatagtgatattaacatggaggattccagcgccgccgcagcgccaccg
tgccaacatccatcttcatcatcatcagctctttcaaagagacctaagagatttgaaatc
aagaagtggaatgctgtcgccttatgggcttgggatattgttgtggataactgtgctatt
tgcaggaatcatatcatggatctctgtattgaatgtcaagctaatcaagctagtaataca
agtgaggaatgcactgttgcttggggtgtatgcaaccacgcattccatttccattgcatc
agtcgttggctaaagacccgtcaagtgtgcccactggacaacagcgagtgggaatttcag
aagtatggccactag

DBGET integrated database retrieval system