KEGG   Papaver somniferum (opium poppy): 113293971Help
Entry
113293971         CDS       T05758                                 

Definition
(RefSeq) calcium-dependent protein kinase 14-like
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
psom  Papaver somniferum (opium poppy)
Brite
KEGG Orthology (KO) [BR:psom00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:psom01001]
    113293971
Enzymes [BR:psom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     113293971
Protein kinases [BR:psom01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   113293971
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like APH Pox_ser-thr_kin Pkinase_fungal DHDPS
Motif
Other DBs
NCBI-GeneID: 113293971
NCBI-ProteinID: XP_026398195
Position
7
AA seq 305 aa AA seqDB search
MSGCLFLPGVCGIGRCWADIKTWVVSWSNNNSKSTLTSFEDRYELGIELGSGNYSVIHEC
FDKRSNETWACKSIAKKRLVTQDDILNVKLEVDITKRLSAHPNIVNLKEVYGDENYVRLV
MELCPGGDLYDHMQKYKSKRLSEFSARRLFQQLLLVVMYCHENGVIHRDLKPENILLATE
GSYLPIKLADFGFATYIQPGEKLYGVFGTRYYIAPEVLTGKVYDQTADIWSAGVILYILL
IGQVPFWGATEATTLDAVMAAKLSFPSDARDQISASAKHLITKILNPDPRKRLTAPQILD
HSWMK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtctggttgtttgtttctccctggtgtctgtgggatcggtagatgttgggcagatata
aaaacatgggttgtttcatggagcaacaacaatagtaaatctaccttgactagttttgaa
gatcggtatgaattgggtatagaattagggtcaggaaactatagtgttattcatgagtgt
ttcgataaaaggagcaacgagacttgggcatgtaaatccatcgcaaagaagagactggta
acacaagatgatatcctaaatgtgaagctggaagttgatataacgaaaagattatcagcg
catccaaatattgtgaatcttaaggaagtttatggggatgagaattatgtccgtttagta
atggaactatgtccaggaggggacctttacgatcatatgcagaaatacaagtccaagagg
ttatcagagttcagtgctaggcgtctttttcagcaactattgcttgttgttatgtattgt
catgaaaatggtgttattcacagagatttgaagcctgaaaatattcttctggcgacagag
ggttcatacttgcccattaaattggctgattttggtttcgcaacttacattcaacccgga
gagaagctttacggagtattcgggactcgatattatatagctcctgaggtactgacagga
aaggtgtacgaccaaacggcagatatttggagtgctggtgttattctttatattcttctt
attgggcaagtaccattttggggagcgacagaagcaacgacccttgatgctgttatggcg
gcgaaactgagttttccttctgatgcacgggatcaaatatctgcatctgccaaacatttg
attactaaaattctaaaccctgatcctagaaagcggctaactgcacctcaaattcttgat
cattcatggatgaaatag

DBGET integrated database retrieval system