KEGG   Papaver somniferum (opium poppy): 113298122Help
Entry
113298122         CDS       T05758                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    113298122
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:psom03041]
    113298122
Enzymes [BR:psom01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     113298122
Spliceosome [BR:psom03041]
 Complex C
  Other components
   Step II factors
    113298122
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_22 AAA_30 AAA_19 DUF2075 ABC_tran Helicase_RecD AAA_16 T2SSE ATPase_2 AAA_14 Sigma54_activ_2 AAA_29 AAA_33 Flavi_DEAD DAP3 NB-ARC SRP54 Dynamin_N
Motif
Other DBs
NCBI-GeneID: 113298122
NCBI-ProteinID: XP_026402581
Position
7
AA seq 701 aa AA seqDB search
MAVAVLPILQFEDKIIETVEQNSVVVVIGETGSGKSTQLSQILHRRGYTNSGIIAVTQPR
RVAAVSVARRVAQELNVLLGEEVGYAIRFEDRTTEKTKIKYLTDGVLLRESLSDPELKQY
SVIILDEAHERSLNTDILLGLVKRLIKMRSSNLKVLITSATLDGTKVSEFFSNCPVLTVP
GKLFPVEILYSSERPTSYLDACLNKALNIHTRQPEGDVLIFMTGQDDIDKCVKKLEERVQ
SLEEGCCMDAIILPLHGSLPPEMQVRVFSPPPPNCRRFIVATNIAETSLTVDGVVYVIDS
GYLKQRQYNPSTGMYSLDIVQISKVQANQRAGRAGRTCPGKCYRLYPSDIYHEDFAEVTI
PEIQRSSLAGSVLYLKSLDLPDIDILKFDFLDPPSRDSLEDALKQLYLINAIDESGTITQ
IGRTMSELPLEPSLSRTLIEANEYGSLSQALTVVAMLSAETTLLPTQSKSIDKKRKQAPS
DLPDGSGWGDHIQLLQVYEDWDRANYDPRWCTDNALQVRGMMFTKDVRKQLSQILQKISK
GPLDVQTNRRRRESRQDYKNLRRALCVGYASQLAERMIHHNGYRTLGFKPQLVQVHPSSV
LKADEDGKLPNYVVYHELITTSRPFMRNVCAVEMSWVMPILQKLEKIDVNKLSGGFATPE
ESLQEQVSDLPKKEADIVDPLDRNNQILAARERFLARKLKK
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atggcagtagcagttcttccgattcttcaattcgaagataaaattatcgaaacagttgaa
caaaattcagtagtagttgtaataggagagactggttcaggtaaaagtacccaactctct
caaatcctacatcgaagagggtacacaaattctggaattattgcagttactcaacctcgc
agagtcgctgctgtctccgttgccagacgagtagcccaagaactgaatgtgctgttaggc
gaggaagttgggtacgctattcgatttgaggatagaacaacggagaagactaagattaaa
tatcttactgatggagttttactccgtgaaagcctttcagatccagagctaaagcaatat
tcagttatcatattggatgaggctcatgaaaggagtctaaacactgacattttgttggga
ttggtgaaacgattgataaagatgaggtcatctaatttaaaggttctgatcacttcagca
actctggatggtaccaaggtatcggagttcttctccaattgtcctgttttgactgtccct
gggaagttgttccctgtggagatattgtacagcagcgagcgccctacaagctatcttgat
gcttgcttaaataaggctctgaatatacacacccgacaaccagaaggagatgtgttaata
ttcatgacagggcaggatgatatcgacaaatgcgttaaaaagttggaggagagagttcaa
agtttagaagaaggatgctgtatggatgctataattcttccacttcatggttctttacca
cctgaaatgcaggtgcgtgtgttcagtccgcccccaccaaactgtaggcggttcattgtt
gccacaaacattgctgagacttctttaacagtagatggtgtagtgtacgttattgattct
ggttatctaaagcaaaggcaatacaacccatcaacgggcatgtactctcttgacattgtc
cagatcagcaaagtgcaagctaatcagcgtgcagggagagctggaagaacttgtcctgga
aaatgttatcggctgtacccctcggatatttaccatgaggattttgccgaagtcacgatc
cctgagatacaacgttcttctcttgctggaagtgtgctttatttgaaatcactcgacctt
cctgatatcgatatcctcaaatttgatttcctcgatccaccctcacgtgattctttagaa
gacgctctgaaacaattatatcttatcaatgcaattgatgaaagtggaactattacacaa
attggaaggacaatgtctgagttgccactagaaccttcactttcgagaaccctgatcgag
gcaaatgagtatggttccttgtcccaggccttgactgtggtagccatgctatcagcagaa
acgacattacttcccactcagagtaagagtattgacaagaagaggaaacaggctccttca
gatttaccagacggttctggatggggtgatcacattcagttgctccaagtgtacgaggac
tgggatcgagccaactatgatccacgttggtgcacagataatgcattgcaggtacgaggg
atgatgttcaccaaggatgtcaggaaacaattgtctcaaatactgcagaaaatatcaaaa
ggaccactggatgtgcaaacaaatcgaagacgacgagaaagccgacaagattataaaaac
ttaaggagggctttatgtgtaggttatgcaagccagttggccgagcgaatgattcaccat
aatggttatagaacccttggttttaaaccacagcttgttcaggtacacccatcttcggtt
ttgaaggcagatgaggatgggaagctacccaactatgtggtgtaccatgaacttattact
acctctcgtcctttcatgcgcaatgtttgtgcagtggagatgtcgtgggtcatgccgatc
ttacaaaaacttgagaaaatagatgtaaacaagctcagtggtggatttgctactcctgaa
gaatctttgcaggaacaagtctcagatcttccaaagaaagaagctgatattgtcgatcca
cttgaccgcaacaaccaaattctagctgcccgagaacgttttcttgctcgaaagttgaag
aagtaa

DBGET integrated database retrieval system