KEGG   Papaver somniferum (opium poppy): 113298737Help
Entry
113298737         CDS       T05758                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 41 homolog
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
psom  Papaver somniferum (opium poppy)
Brite
KEGG Orthology (KO) [BR:psom00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:psom04131]
    113298737
Membrane trafficking [BR:psom04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    113298737
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin WD40 zf-RING_2 WD40_like ANAPC4_WD40
Motif
Other DBs
NCBI-GeneID: 113298737
NCBI-ProteinID: XP_026403340
Position
7
AA seq 948 aa AA seqDB search
MGHSPSENGVEGDDEREEEEEDDDEEEEDEEVEEEEEEDEPRLKYQRMGGSIPTLLSNDA
ASCIAVAERMIALGTHDGTIHILDFLGNQVKEFRSHTATVNDLSFDIDGEYVGSCSDDGF
VVINSLFTDEKMNFDYRRPMKAISLDPEYSRSSSRRFVAGGLAGQLFMNAKKWLGSRDQV
LHSGEGPIHAVKWRTSLIAWANNAGVKVYDTANDQRITFIERPTGTPRPELLLPHLVWQD
DTLLVIGWGTSVKIAAIIGNAYTGANGTQRHVAFSSMKQVDIVASFQTSYSISGIAPYGD
ALVVLAYIPEKEDGEKEFSSTAPSRQGNAQRPEVRIVTWKNDELTTDALPVHGFEHYKAK
DYALAHAPFSGSSYAGGQWAAGDEPMYYVVSPKDVVIAKPRDAEDHIAWLLQHGNHEKAL
AAVEAGQGPTELLDEVGTRYLDHLILERRYADAASLCPKLLRGSSSAWERWVFHFAHLRQ
LPVLVPFIPTENPRLRDTAYEVALVALATNPSYHKDLLSTIKSWPSVIYSALPIISAIEP
QLNTSSMTDALKETLAELYRIDGQYEKALGLYADLLKPELFDFIEKYNLHDAIREKVVEL
MILDAKRAVSVLIHHKDLIPPVEVVPKLLAARKKCDSRFFLHLYLHSVFVTSTDAAKDFH
DMQVELYADYDQKMLLPFLRSSQHYHLEKAYEICVKRNLLREQVYILGRMGNSKKALAVI
VNKLEDIEEAVEFVTMQHDDELWEELIKQCLHRPEMVGMLLEHTVGNLDPLYIVNMVPNG
LQIPRLRDRLVKIITDYRTETSLRHGCNDILKADCVNLLVKYYKEARHAVCLGGGEDEVR
PKRDDNGRSTGNDRRGGSAAGSIKRLEVKYKTRGGGRCCMCFDPFSIQDVSVTVFFCCHA
YHTSCLMDSMHSLSSTSEKDDSDDDDKDDENKSSLPRIRCILCTTAAQ
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgggtcatagtccttcagagaatggagttgaaggagatgatgaaagagaagaagaagaa
gaagatgatgatgaagaagaagaggatgaagaagttgaggaagaggaggaagaagatgaa
cctagattgaagtatcaaagaatgggaggaagtattcctacgcttttatctaatgatgct
gcttcttgtattgctgttgctgaacgtatgatcgctcttggaactcatgatggaactatt
catatccttgattttctcggaaatcaggtgaaggagtttcgttctcacacagctactgta
aacgatctcagctttgacatagatggtgaatacgttgggagttgctcagatgatggattt
gtagtaataaatagtctgtttactgatgagaaaatgaactttgactatcgccgccccatg
aaagcgatctctcttgacccagaatactcaagaagttcatctcggaggtttgttgctggt
ggtttagctggtcagttatttatgaatgcaaagaaatggctaggatcccgtgaccaggtt
ctacactcgggcgagggtccaatacatgcggtgaagtggagaactagccttattgcatgg
gctaataatgctggggtcaaagtatatgacacagcaaatgatcagcgcatcacatttatt
gagaggccaacaggaaccccacgccctgagctcttactacctcatctagtttggcaggac
gatactctcttggttattggttggggaacttcagtaaaaattgctgcaataatagggaac
gcttacacaggagccaatgggacacaaaggcatgtggccttttccagtatgaaacaggtt
gatattgtggcgtctttccaaaccagctattccatttcaggaattgcaccctacggtgat
gctttggttgtccttgcttatattcctgaaaaagaggatggagaaaaagaattcagtagc
actgctccatcacgtcaggggaatgcacagagaccagaagtacgtatagtcacgtggaaa
aatgatgagcttacaactgatgctcttccagtacatggttttgagcattacaaggcaaag
gattatgctctcgctcatgctcctttctcaggtagcagctatgcaggtggtcaatgggct
gctggggatgaaccgatgtattacgtagtctctcctaaggatgttgtcattgcgaagcct
agggatgctgaagaccatatagcttggcttcttcaacacgggaatcatgagaaagcattg
gctgcggttgaggcaggacagggaccaacagaacttctcgatgaggttggaacaagatac
cttgatcatctgattttggaaaggagatacgctgacgctgcttctttgtgccccaagttg
ttgcgtggatcttcttcagcatgggagagatgggttttccactttgctcatcttcgccag
cttcctgtcttggttccattcataccaactgaaaatccaaggttgcgcgatactgcttat
gaggttgctttagtggctctggcaacaaatccttcttatcacaaggacctcctatcaact
attaaatcttggccatcagtgatatattctgcattgcctattatttcagcaatagaaccc
cagcttaatacgtcatccatgactgatgcacttaaagagactttggctgagttgtataga
atcgatggacagtatgagaaagcccttggattatacgctgatctcttgaagcctgaattg
tttgacttcatcgaaaagtacaacttacatgatgccattcgtgaaaaggttgttgagctg
atgatattggatgctaaacgagcagtctctgtactgatccaccacaaggatttaattcct
ccagtggaagttgttccaaaactattggctgctcgtaaaaagtgtgattcaagatttttt
ttgcacttatatctgcattcagtatttgtgactagtacagatgctgcgaaagatttccat
gatatgcaggtggagctctacgctgactacgatcaaaagatgttgcttccttttcttcga
agcagtcagcattatcatcttgagaaggcatatgaaatttgcgtcaaaaggaatcttttg
agagaacaagtctatatccttggacggatgggcaactcaaaaaaagctctggctgtcatc
gtgaataagctagaggacatagaagaggctgtagaatttgtgactatgcaacatgacgat
gaactctgggaagaactaattaaacaatgtctacacagacctgaaatggtgggaatgctg
ttggagcacactgttggtaaccttgatccgttatacattgtaaatatggtccccaatggt
ttacagatacctcgtcttagggatcgtctagtcaaaatcattacagattacaggacggag
acgtctcttagacatggatgcaatgatattctaaaggcagattgtgttaacctgttggtg
aaatactataaggaagcacggcatgcagtttgcttgggtggtggagaagatgaagtgcga
cctaaaagagatgacaacggcaggtctacaggtaatgatagaagaggaggatcagctgcc
ggaagtattaaaaggctagaggttaagtacaaaacaagaggcggtggaaggtgttgtatg
tgctttgatccgttctcaattcaggatgtatctgtcaccgtgttcttttgttgtcatgcc
tatcatactagctgccttatggattcaatgcattctttaagcagtacaagtgaaaaggat
gacagtgacgacgacgataaagatgatgaaaacaagtctagtttaccccgaattcgttgt
atcctatgtactacagctgctcaatga

DBGET integrated database retrieval system