KEGG   Papaver somniferum (opium poppy): 113299261Help
Entry
113299261         CDS       T05758                                 

Definition
(RefSeq) rust resistance kinase Lr10-like isoform X1
Organism
psom  Papaver somniferum (opium poppy)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr ABC1 APH Kinase-like
Motif
Other DBs
NCBI-GeneID: 113299261
NCBI-ProteinID: XP_026404034
Position
7
AA seq 438 aa AA seqDB search
MSLLPPKPVLPRPPPIPHVPLSTPLSRSALIAGAVLLGIVVILVVYRAIKKESAAEKDLK
ASKGSEVTVTEPPYQLWQVGSETMEKFILNMASEKPIRFTTQELHSVTNNYATRLGSGGF
GVVYRGQLPNGIKIAVKVLNKSEDKNVEEQFMAEVGTIGRTYHINLVRLYGFCSDHQTSA
LIYEYMENGSLDRFLFNKEALKFKWEKLLDIARGTAKGLAYLHEDCHQRIIHYDIKPGNV
LLDQYFLPKVADFGLAKLCNRESTHVSFTGYRGTPGYSAPEFLLHNYPITHKCDVYSFGM
LLFEMVTRQRNFQRRPVSEIIDWFPKKAWEEYEKGRLTDLIFQIGIEEQDKVKAERMFMT
AFWCVQDSPDSRPLMSTVVKMLEGGVEILPPSNPFRYLFASSPTDVVIDSYTTRSDSSWY
KDSAPIMKKQDIQMTSSR
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgcttccgccgaaacctgtattgccacgacctccgccaatcccgcacgtccca
ttgtcgactcctttgtcgcgttcagctctaattgcgggtgcagtactcctgggtattgtt
gttatcttggttgtttatcgtgctataaagaaggaaagcgctgcggagaaggatttaaag
gcttcaaagggtagtgaagtcactgtaactgagccaccataccaactctggcaggttggt
tcagaaacaatggagaaatttatacttaatatggctagtgaaaaacccattagatttact
actcaagaacttcatagtgttactaataattatgcaacaaggttgggttcaggaggtttt
ggggtagtctaccgaggacagttacctaatggaatcaaaattgcagtgaaggttctgaat
aaaagtgaagacaagaacgttgaagagcagttcatggcagaagtaggaactattggtaga
acttaccatattaatctagttagattgtatgggttctgctctgatcaccaaacaagtgca
ctcatctatgagtacatggaaaatggctcactcgacagattcttatttaataaagaagca
ctgaaattcaaatgggaaaaactcctagacattgcaagaggcacagcaaaaggacttgct
tacctgcatgaagattgtcatcaaaggataattcattatgatataaagcctggtaatgtt
cttcttgaccaatattttttacccaaagttgcagattttggacttgccaagctttgcaat
agagaaagtactcatgtatccttcactgggtacagaggaacaccgggttattcagctccg
gagtttcttttacataattatccaattacacataaatgtgatgtttatagctttgggatg
ttgttgtttgagatggtgacgaggcagagaaacttccaaaggcgtccagtttcagaaata
atagactggtttccgaagaaagcttgggaagagtacgagaagggtcgactgacagactta
atattccagattggaattgaagaacaagataaagtgaaggcagaacgaatgttcatgact
gcattctggtgcgttcaagattctcctgattcaagacctttgatgagtactgtagtgaag
atgttggaaggtggagttgaaattctccccccatcaaatccatttcgatacctatttgca
tcaagtcctacagatgtggtcattgattcatacaccacaagaagtgattcatcttggtac
aaggattcagcaccaattatgaagaaacaggacatacagatgacaagttcaagatga

DBGET integrated database retrieval system