KEGG   Papaver somniferum (opium poppy): 113299452Help
Entry
113299452         CDS       T05758                                 

Definition
(RefSeq) autophagy-related protein 16-like
  KO
K17890  autophagy-related protein 16-1
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:psom00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    113299452
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:psom04131]
    113299452
   03029 Mitochondrial biogenesis [BR:psom03029]
    113299452
Membrane trafficking [BR:psom04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    113299452
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    113299452
Mitochondrial biogenesis [BR:psom03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    113299452
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ATG16 ANAPC4_WD40 eIF2A PQQ_2 Ge1_WD40 WD40_like Cytochrom_D1 DUF641 VID27 HD_2
Motif
Other DBs
NCBI-GeneID: 113299452
NCBI-ProteinID: XP_026404255
Position
7
AA seq 511 aa AA seqDB search
MIMNPEELAMRAINHALNALKKRHLLEEGAHAPAFIALSRPFASQGSEWKEKAENFELEL
QQCYKAQSRLSEQLVTEVAECRTAKALVQEKETLINDLQTEVTQTREECSQLKESLEEKT
KALDLVMSENKELRAQLEEMTLKAKTAEDENKMLIDRWMLQKMQDAERLNEANALYEEMM
NRLKASGLEQLANQQVDGVVRQFEAGAENFAGSTVPTACKHKIPAHEGGCTSILFEYQSD
RLISGGQERSVKIWDTKTGMLTRTLDGSLGSILDLTVTHDNRYIIAASSSCNLYAWDVNS
GRIRHTLTGHKDKVCAVDVSKVSSSLVVSAAYDRTIKLWDLQKGYSTLTMMSHSNCNSLC
FSMDGQTICTGHTDGNLRLWDITKGEVVSEVAAHSNAITSISISRSGNIILTSGRDNLHN
LFDMRSMEVCGTFRATGNRLANNWSRSCISPDDSYVTSGSADGSVYVWSRFRSDVVSTLK
EDYSPINACAWSGLGKPLVSADKDGTICIWT
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgaatccggaggaattagccatgagagctataaaccacgctttgaatgcctta
aaaaaacgtcatttacttgaagaaggagctcatgctccagcttttatagcgctttcaagg
cctttcgcatctcagggttcagaatggaaagaaaaagcggaaaactttgaattagaactg
caacaatgttataaagcacaatcaagattatctgaacaacttgtgacagaagtggcagaa
tgtagaactgcaaaagcattggtacaagagaaagaaacattgattaatgatcttcaaact
gaggttactcagacaagagaggagtgctcgcaattgaaagaaagcctggaagaaaagacg
aaagcgctggatttggtaatgagtgagaacaaagagctaagagcacagctagaagaaatg
actttgaaggcaaaaactgctgaagatgaaaacaagatgttgattgatcgttggatgttg
caaaagatgcaggatgctgaacgacttaatgaggctaacgctttatacgaagaaatgatg
aatcgactaaaagccagtggtttagaacagcttgcaaatcagcaagttgatggtgtggtc
cgacaatttgaagcaggagctgagaactttgctggatcaaccgttcccactgcttgcaag
cacaagataccagcccatgaaggtgggtgtacttcaatcttgtttgaataccagtcagat
aggttaatcagcgggggtcaagagcgcagtgtcaaaatttgggatacgaaaactgggatg
cttacccgtactctggatggaagcctaggctctattcttgatctcactgttacccatgat
aacagatacattattgctgcaagcagctcgtgcaacttatatgcatgggatgtgaattct
ggcaggattcgtcatactcttacaggccacaaagacaaagtttgtgctgtagatgtgagc
aaagtttcaagcagtcttgtagttagtgctgcttatgatcgaacgataaaactttgggat
ctacagaaaggctactctactttgacgatgatgtcccacagcaactgtaattctctttgt
tttagcatggacggacaaacaatttgcacaggtcatactgatggaaacctccggttgtgg
gatattacaaaaggggaggtagttagtgaagttgctgcacattcaaatgccattacatca
atcagtatctctcgaagtggtaatattatattgactagtggaagggacaatctgcacaac
ctatttgatatgcgttcaatggaagtttgtggcacgtttagggcaacagggaacagattg
gcaaataattggagtcgttcctgcatcagtccagacgatagctatgttacatcaggttct
gctgatggttctgtttatgtttggtcaagatttagatcggacgtagtgagcactttaaag
gaagattattctcctatcaatgcttgtgcatggagtgggttgggaaagcccttagtttca
gcagataaggatggaactatttgcatatggacatga

DBGET integrated database retrieval system