KEGG   Papaver somniferum (opium poppy): 113301865Help
Entry
113301865         CDS       T05758                                 

Definition
(RefSeq) probable glycosyltransferase At5g20260
  KO
K18789  xylogalacturonan beta-1,3-xylosyltransferase [EC:2.4.2.41]
Organism
psom  Papaver somniferum (opium poppy)
Brite
KEGG Orthology (KO) [BR:psom00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:psom01003]
    113301865
Enzymes [BR:psom01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.41  xylogalacturonan beta-1,3-xylosyltransferase
     113301865
Glycosyltransferases [BR:psom01003]
 Polysaccharide
  Structural polysaccharide
   113301865
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exostosin Glycos_transf_1
Motif
Other DBs
NCBI-GeneID: 113301865
NCBI-ProteinID: XP_026406492
Position
8
AA seq 458 aa AA seqDB search
MADLMIICRTHFILFGSFLSILLLTLYFSPYNNHQTPNSTLSRASPLLASDGNGIRSESS
NAPNTREKLTGAGKIEDDLSRARAAIRMAIQTRNYTSNKVEDFIPSGTVYRNSYAFHQSY
IEMERTFKIWTYKEGEPPLVHAGPLNLLYAIEGHFIEEMASKSNPFAAQDPSDAHAFFLP
FSVANMKSFLYVPYSKDYSRAPINHLVMDYVRIVSEKYHYWNRSSGGDHFMVSCHDWAPF
VTEENPRMFKKFIRVLCNANSSESFEPGRDVSLPEYRVEGTSLLTSTQSRVSVSNRSILG
FFAGGGHRPIRKMLLKHWLDKDSQLQIHEYLPKGQDYGEFMMRSKFCLCPSGYEVASPRL
VEAIHAGCVPVIMSDHYVLPFSDVLVWSQFSIAVTIEEIPQLKTILQAITDEQYHELQKR
VIQVQRHFTLNRPAQRFDIIHMILHSVWLRRLNVHLPA
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcagaccttatgatcatttgcagaacacatttcatactctttggttcttttctttct
attctccttcttactctctatttttcaccttataacaatcatcaaacaccaaatagtact
ttgtctcgcgcttctccgttactagcttccgatggtaatgggatccgttcggaatcatct
aatgctcccaacactagagaaaaacttactggtgcggggaaaattgaagatgacctttca
agagctagggctgccattcgaatggcgatccaaacacgcaattacacgtctaacaaagta
gaagatttcattcccagtggaacagtttacaggaattcatatgcctttcaccagagctat
attgagatggagagaacatttaaaatttggacatacaaagaaggtgagccacctttggtg
catgctgggccacttaatttgctctatgcaatagaaggccactttattgaagaaatggcg
agcaaaagcaaccccttcgcagctcaagacccgagtgatgcccatgcgttcttccttccc
ttcagcgtagccaatatgaaaagtttcctttacgtgccctacagtaaagattattcgcgt
gctccaattaaccatttggttatggattatgttcgcattgtatcagagaaataccattac
tggaacagaagcagtgggggtgatcatttcatggtctcttgccatgattgggcacctttt
gtaaccgaggaaaatcctagaatgttcaagaaattcatcagggttctctgcaatgctaat
tcgtcagaaagttttgagcccggaagagatgtatcgctgccggaatacagagtcgaggga
acaagtcttttgacctccacacagtctcgcgttagtgtttctaatcgctccattcttggt
ttctttgctggtggaggacatagacctataaggaagatgttacttaagcattggttagac
aaagatagtcaattgcaaattcacgaatatcttcctaagggacaagattatggtgaattt
atgatgcgaagcaaattctgtttgtgtccaagtggatatgaagttgccagtccaagatta
gtggaggcaatccatgccggatgtgttcctgttataatgtcggatcattatgttcttcca
tttagtgatgtacttgtctggagccagttctcgatagcagttacaatagaagaaataccc
caacttaagacgatactgcaggctataacagatgagcagtaccacgaattgcagaagagg
gttatacaagttcaacggcatttcactcttaatcgcccggcacaaaggttcgacattatt
catatgatacttcattcagtttggctaaggcgattaaatgttcatctaccagcttga

DBGET integrated database retrieval system