KEGG   Papaver somniferum (opium poppy): 113304218Help
Entry
113304218         CDS       T05758                                 

Definition
(RefSeq) calmodulin-binding receptor-like cytoplasmic kinase 3
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
psom  Papaver somniferum (opium poppy)
Brite
KEGG Orthology (KO) [BR:psom00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:psom01001]
    113304218
Enzymes [BR:psom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113304218
Protein kinases [BR:psom01001]
 Serine/threonine kinases: TKL group
  IRAK family
   113304218
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase APH Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-GeneID: 113304218
NCBI-ProteinID: XP_026409061
Position
8
AA seq 385 aa AA seqDB search
MTVAGIFILCFSMICPCWFPKKKDISEVNLAVEHSANSASSTEASISVENLPGSPVRVPA
SPFRVPPSPSRFSQSPRTTAVGSVHLNMSQVIKATQNFSPSLLIGEGGFGTVYRGLLQDG
QVVAIKRAKKENLISLQAEFSSEVELLSKIEHRSLVRLLGYVDKGNERIIITEFVPNGTL
REHLDGQRGKILDFYQRLEISIDVAHALAYLHLYAEKQIIHRDVKSSNILLTENLRAKVA
DFGFARAGPTDVEKTHISTKVKGTAGYLDPEYLRTYQLTPKSDVFSFGILLIEILTGRRP
VEMKRASDERITIRWAFKTFNAGKAAEMLDPSMKEVVHTGILSKMFSLAFQCAAPTRGDR
PNMKEVAEQLWAIRMNYLKSVKRGE
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgacagtagctgggattttcattctgtgtttcagtatgatttgtccatgctggtttcca
aaaaagaaggatatatctgaagttaaccttgccgtggagcacagtgccaattcagcatcc
tcaacggaagcaagtatttctgttgaaaatctcccaggcagtccagttcgtgtgccagcc
agcccatttcgggtgccacctagtccttctagattctcacagtcgcccagaacgactgca
gttggatctgtacatctaaatatgagtcaggttattaaagctactcaaaacttttcacca
tctctgctgataggtgaaggaggctttggaactgtctacaggggtctgttacaagatggt
caggttgttgccatcaaacgtgcaaagaaggaaaatcttatcagtttacaagctgagttc
agcagtgaagttgaactgctatcgaaaattgaacatcgaagtttagttaggctacttggc
tatgtggacaaagggaatgagcgcattatcattacagagtttgttcctaacggtactctt
agggagcatctggatggtcagcgtggcaaaattcttgatttttatcaacgtctagaaata
tccatagatgtggctcatgcactggcctatcttcatctatatgcagaaaaacaaataatt
catcgagacgtaaagtcgtccaacattttgctgacagagaatttgagggcgaaggtggct
gattttggttttgctagagctgggcctactgacgttgagaaaacacatatatcaacaaaa
gtgaaagggacagcgggctacctcgaccctgagtacctgaggacctatcaactcacccct
aagagtgatgtgttttcatttggaattttgctcatagaaattctaactgggcgtagacca
gttgagatgaaaagagcttctgatgaaaggatcacaataagatgggctttcaaaaccttc
aatgctggaaaagctgcggagatgctggatccttcaatgaaagaagttgtacacactggg
attctgtcaaaaatgttttctctagctttccaatgtgcagcacctacacggggagatcgt
ccaaatatgaaagaagttgcagagcagctgtgggcaatcaggatgaactacctgaagagt
gtaaagagaggagagtga

DBGET integrated database retrieval system