KEGG   Papaver somniferum (opium poppy): 113307626
Entry
113307626         CDS       T05758                                 

Definition
(RefSeq) delta(14)-sterol reductase-like
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00100  Steroid biosynthesis
psom01100  Metabolic pathways
psom01110  Biosynthesis of secondary metabolites
Module
psom_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    113307626
Enzymes [BR:psom01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     113307626
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 TMEM132D_C
Other DBs
NCBI-GeneID: 113307626
NCBI-ProteinID: XP_026411861
Position
9
AA seq 369 aa
MELESIIQSSIPTWSSVCILVSYLLYLGLAGSLLPGNDVPGALLQDVTRLRYRCNGLLTL
FLLIALLLFGVVFEFISPTVIADRGLELLSTTFCFSVLVTLILYVTGCNSRAKGSSLKSH
ATGNLIHDWWFGVQLNPHFMGVDLKFFFVRAGMMGWLFINLSVMEKSYKDGSLGQSMILY
QLFCGLYILDYFCFEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLRNNVELP
KAAAVVNILVFLIGYRIFRGANKQKHDFKKDPKAPIWGMPPKVIGGKLLASGYWGVARHC
NYLGDLLLALSFSLPCGASSPVPYIYPIYLLILLIWRERRDESRCAQKYREIWSEYCKLV
PYRILPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggagttggaatcaattattcaatcttcaattcctacatggagttcagtatgtatactg
gtctcctacttactttacttaggtcttgctgggtctcttcttcctggtaatgatgttcct
ggtgcccttttacaagatgttactcgtctccgttatcgctgcaatggtcttttaactctt
tttcttcttattgcgttacttttatttggagttgttttcgagtttatatcgcctacggtt
atagctgatagaggacttgagttactttctacaactttttgtttcagtgttctcgtgaca
ttgatactctatgtcactggttgcaactctcgcgctaaaggttcatctctaaaatcacat
gcaacaggaaatttgatccatgactggtggttcggggtacagctgaatcctcattttatg
ggagtcgatctaaagtttttctttgttagagctggaatgatgggatggctatttattaat
ctctcagttatggaaaaaagttataaagatggcagcttgggtcaatcaatgatcctttac
cagctgttttgtgggttgtatattttggactacttctgttttgaggagtacatgacctcc
acatgggacattattgcagaaaggttgggcttcatgttagtatttggagatttagtgtgg
attccgttcacttttagtattcagggttggtggcttttaagaaacaacgtggagctacca
aaggctgctgctgtagtgaacatcttagtgtttctgattggttaccggatctttagagga
gctaacaaacaaaagcatgactttaagaaggaccccaaagctcctatatggggtatgccc
cctaaagttattggcggaaaattgcttgcttctggttactggggagtggcaagacactgt
aattaccttggtgacttactgttagcactatcctttagcttaccttgtggggccagctcc
ccagttccttacatttatcctatctaccttcttattcttttaatatggagagaacggagg
gatgaatcacgatgtgcacaaaagtatagagaaatctggagcgaatactgcaagcttgtt
ccatatagaattttgccatatgtatactag

DBGET integrated database retrieval system