KEGG   Papaver somniferum (opium poppy): 113307965Help
Entry
113307965         CDS       T05758                                 

Definition
(RefSeq) insulin-degrading enzyme-like 1, peroxisomal
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
psom  Papaver somniferum (opium poppy)
Brite
KEGG Orthology (KO) [BR:psom00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:psom01002]
    113307965
Enzymes [BR:psom01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     113307965
Peptidases and inhibitors [BR:psom01002]
 Metallo peptidases
  Family M16: pitrilysin family
   113307965
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C PI3K_p85B
Motif
Other DBs
NCBI-GeneID: 113307965
NCBI-ProteinID: XP_026412217
Position
9
AA seq 968 aa AA seqDB search
MAVGITDGAITKPHTDNREYRRIVLPNSLEVLLISDPETDKCAASMSVGVGYFSDPEGLE
GLAHFLEHMLFYASEKYPVEDSYSKYITEHGGSTNAYTSTEHTNYFFDVNTDSFEEALDR
FSQFFIKPLMSADATTREIKAVDSENQKNLLSDAWRMTQLQQHLSTEGHPYHKFGTGNWD
TLEVRPKQKGLDTRNELIKFYEEHYSSNIMRLVIYGKKNLDDLQSLVDQKFKEIRNTDKN
CFHFSGQPCKAEHLQILVKAIPIKQGHKLKIVWPITPSILHYKEAPCRYLGHLIGHEGEG
SLFCILKTLGWATGLSAGEDDSSNDYAFFKVNIDLTDSGNEHMEDIVGLLFKYVILLQQS
GVSKWIFDELSAFCETVFRYQDKTRPINYVAKVSSNMQLYPAKDWLVGSSLPSNFSSSII
QMILDELTPANVRIFWESKIFEGQTDKVEPWYGTGYSLENINSSAIQQWISAAPNQNLHL
PAPNVFIPTDLSIKDLTEKVKFPVLLRKSSYSRLWYKPDTMFFTPKAYVKIDFNCPYTSH
TPEAVVLTDVFTRLVMDYLNEYAYDAQVAGVYYGINSTDTGFQVIVTGYNHKMRILVDKI
IEQIQEFKVKPERFAVIKETVLKEYQNYKFQQPYQQAMYYCSLILADASWPWTEQLEVIP
HLEADDLAKFSTMLLSKAFVECYAAGNIEPKEAEEMVIHIEDIFFKGLQPIARPLFPSEH
LTNRIVKLESGISHFYPAEVLNPSDENSALVHYIQVHQDSTMLNVKLQLFALIAKQPVFH
QLRSVEQLGYITVLMQRNDSGIRGLQFIVQSTAKDPGQIDLRVESFLKEFESKLYEMPAD
EFMSNVNALIDMKLEKHKNLSEETSFFWREIFDGTLKFDRREIEIAALKNLRQQELIDFF
DEYIKVGAPAKKTLSVQVYGGSHSSNYEASTKEISSHPQSVLIEDIFSFRRSQPLYGSFK
GGSGLMKL
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atggcggttggaattacagatggagcaattactaagcctcatacagacaacagggagtac
cgaagaatcgttctccctaactctctcgaagttcttctcattagtgatcctgaaactgat
aagtgtgctgcatctatgtctgttggtgtgggttactttagtgatcctgaaggtcttgaa
gggcttgcccactttctagagcatatgctgttttatgcaagcgaaaaatatccagtggaa
gacagttattcaaagtatattacggagcatggaggctctacgaatgcttacacatccacc
gagcatactaactacttttttgatgtcaatacagactcttttgaagaagctcttgatagg
ttctctcagttctttattaaacctttgatgtctgctgatgctaccacaagggaaataaaa
gcagtggattctgaaaatcagaagaatttattgtcagacgcatggagaatgactcagctt
cagcagcatctatctacagaaggtcacccgtatcataaatttggtacagggaattgggat
acattagaggttcgtccgaaacaaaaaggactggatacaagaaatgagcttattaaattc
tacgaagaacactattcttctaacatcatgcgtttggtcatatatggaaaaaagaatctt
gatgacctacaaagtctggtggatcagaaattcaaagaaattcgcaatactgataaaaat
tgtttccatttttcgggtcagccttgtaaggctgaacatcttcagattcttgttaaagct
atccccataaagcaaggtcacaaattaaaaattgtgtggcctatcactccaagcatcctc
cattataaagaagccccatgtaggtatctgggtcacctgattggccatgaaggagaagga
tctttgttttgcatcttgaaaacgctaggttgggcaacgggtttgtccgcgggtgaagat
gattcgagtaacgattatgcgttctttaaagtaaacattgatcttactgattctggcaat
gagcatatggaagatattgttggattgttgttcaaatatgttatccttttacaacaatct
ggtgttagtaaatggatttttgatgagctctctgccttctgtgagactgtgttccgttat
caagataaaactcgtcctatcaattatgtggcaaaagtttcatcaaacatgcagctatat
cccgcaaaagactggctagtaggttcttcattgccttctaacttcagctcaagcattata
cagatgatacttgatgagctaactccagcaaatgtaagaatattttgggaatcaaaaatt
tttgaaggacaaacagacaaggttgagccttggtatggaactggctattccctcgagaat
attaatagttcagcgatacagcaatggatttctgcagctcccaatcaaaacctacatctt
ccagcacctaatgtgttcatcccaactgatttatcaattaaggatttgacggaaaaggtt
aaatttccagttttgttaaggaaatcatcatattccaggttatggtataagcctgatacc
atgtttttcactcccaaggcttatgttaagatagatttcaattgtccatatacaagccac
accccagaagctgtggttcttactgatgttttcacacgattagtaatggactacttgaac
gaatatgcttatgatgctcaggttgctggtgtatactatgggataaacagcactgatact
gggtttcaggttattgtgactggttataatcacaaaatgaggatcttagtggacaaaata
attgagcagatacaggagttcaaagtaaagccggaaagatttgctgtaattaaggaaact
gttttaaaggagtaccaaaattacaagtttcagcagccgtatcagcaagctatgtattac
tgttcattgattttggcggatgcatcgtggccttggaccgaacagctagaagttattcct
catctagaagctgatgatcttgccaagttctcaactatgcttctctcgaaagcctttgta
gagtgttatgcagcagggaacattgaaccaaaggaagcagaggaaatggtcatccatatt
gaagacatctttttcaagggtctccaacccatagcaagacctcttttcccttccgagcat
ttgacaaatcgaatcgttaagcttgaaagtggaattagtcacttctacccggcggaagtt
ttaaacccaagtgatgagaattctgccttggtccactatattcaggttcaccaggatagt
acgatgttgaatgtgaaacttcagctttttgctcttattgcaaagcaaccagtgttccac
cagcttcgctcagttgagcaacttggatacataacagtgcttatgcagaggaatgattct
ggcatccgaggactgcaatttattgttcaatcaacagcgaaggatcctgggcagattgat
ttgagagttgaatcattcctcaaggagtttgagagtaaactttatgagatgcctgctgat
gaattcatgagtaatgtaaatgcactgattgatatgaagcttgaaaagcacaaaaattta
agcgaagaaacttcattcttttggagagagatttttgatggcactctaaaatttgacagg
agagagatcgagattgcagcattgaagaacttaaggcagcaagagttgatagattttttt
gatgaatacattaaagtgggtgcaccggcgaaaaagacgctatcggtacaagtatatggg
ggttcacattccagcaattacgaagcgtctactaaagaaatatcctcgcatcctcaatct
gtcttaatcgaggatatattcagcttcaggaggtcacagcctctatatggttcctttaag
ggaggcagtggtcttatgaaattatag

DBGET integrated database retrieval system