KEGG   Papaver somniferum (opium poppy): 113308609Help
Entry
113308609         CDS       T05758                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00010  Glycolysis / Gluconeogenesis
psom00562  Inositol phosphate metabolism
psom01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    113308609
   00562 Inositol phosphate metabolism
    113308609
Enzymes [BR:psom01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     113308609
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     113308609
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 113308609
NCBI-ProteinID: XP_026412854
Position
9
AA seq 506 aa AA seqDB search
MTKFHFLVLIGMANFLWMFLCYVFLLKSDTVEGFDVRKHLSTVTSYAVGKELANDGFVSS
SIPNGCTPIHLNLVARHGTRSPTKKRIRELDRLASHLEDLVNDAKDAAEKGKLALERVPA
WIQGWQSPWKGRKKGGELISKGEDELYNLGIRIRERFGDLFSEEYHPDVFTIKATQVPRA
SASAVAFGMGLFAERGNLGPGKHRAFSVTSESHASDLLLRFFDTCETYKQYRKNQEPTVL
KLKQPILDQISSALVSRYQLNFTTQDAASLWFLCKQEASLLEVTDQACGLFTPSEVSLLE
WTDDLEVFMLKGYGKSVNYRMGLPLLRDVVDSMEQAIKAKEEHHVAGTFEKARLRFAHAE
TVVPFSCLLGIFLEGAELARLKHEQALELPPKPPQKRNWRGSVVAPFAGNNMLVLYNCPT
KQTSKYYVQVMHNEVPVPLPGCDGSDFCSFEVFKEKIVNPHLQHNYNSVCSAKLEEPETL
SFSILGGAQTGLLIDLSTESWLNLNF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaatttcattttctggttctgatcggaatggctaattttctttggatgttcctc
tgttacgtgttcttattgaaatcagacacagtggaaggatttgatgttcgaaaacatctc
tctaccgttacaagctatgctgttgggaaagaacttgctaatgatggatttgtgtcatct
agtatcccaaatggatgcactcctattcacttaaatcttgtggcaagacatggaactcgt
tctcctaccaagaaaaggattagagagttagatagattggcgagtcacttggaagattta
gtgaatgatgcaaaagatgcggcagaaaaaggcaagttagctcttgaaagagtccctgcc
tggatacagggatggcagtctccttggaaaggaaggaaaaaaggcggagagttgatttct
aaaggggaggatgaactatataatcttgggattagaatcagagaaagatttggagattta
ttcagtgaggagtatcacccagacgtgttcactataaaagcaactcaagttcctcgggca
tcagctagtgcagtggcatttggcatgggtctatttgcggagagaggtaatctgggacca
gggaagcatcgagcattttctgtaaccagtgagagccatgcaagtgatttattactgagg
ttttttgatacttgtgaaacttacaagcaatacaggaaaaatcaggaacctactgtccta
aaactaaagcaacccatcttggatcaaatttcctctgccttagtgagtcggtaccagctg
aactttacaacacaggatgctgcttccctctggtttctgtgtaagcaggaagcatccttg
ctggaggtaactgatcaagcttgtggcctctttaccccttctgaggtttctttgctggaa
tggactgatgatttggaggtattcatgttgaagggttatggtaaatcagtgaattatcga
atgggattaccactgcttcgagatgttgttgactccatggaacaagctataaaggctaaa
gaagagcaccatgttgctggcactttcgagaaagcaagactacgatttgctcatgccgaa
actgttgtaccattttcgtgtctgcttggaatctttcttgaaggagctgagttggcaaga
ttaaaacacgagcaagccttggaactacctccaaagcctcctcagaaaaggaactggaga
ggtagtgtggtggcaccttttgctgggaacaatatgctggttttgtataattgtccgacc
aaacagacatccaagtattatgtgcaagtgatgcataacgaagttccagttcccttgcca
ggttgtgatggttctgatttttgctcatttgaagtttttaaggaaaagatcgtcaatccc
catctgcagcacaactacaattcagtctgcagtgcaaaattagaagaaccagaaacactc
tccttctctatccttgggggtgcacagacaggcttattgatagacttgtcaactgagagc
tggctcaatcttaacttctga

DBGET integrated database retrieval system