KEGG   Papaver somniferum (opium poppy): 113311289Help
Entry
113311289         CDS       T05758                                 

Definition
(RefSeq) probable serine/threonine-protein kinase PBL7 isoform X1
Organism
psom  Papaver somniferum (opium poppy)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-GeneID: 113311289
NCBI-ProteinID: XP_026415915
Position
1
AA seq 360 aa AA seqDB search
MAKKSIFRFGGSPSNNVEDYAVITKFKFQELAAATENFAQESLLGEGEYGRTFRGCLKSS
GQKSSSLDVAIRQVDDETICTIHGYHDPSMFSSIHMRSLLHHPNIVDLIGYSIADKDQLF
LVYNFMPLGSLKDYLHDLPRNKKPLDWNTRMKIAAGAAKGIKYLHDKSTPPVILGNIKPS
NILLCAEYLPKLSDFLGFKERIPEHDESSHTRYFSRQCHRHAPEFVGDCKLTQQSDIYSF
SLVLLELVSGRLAEIEPSLIGWAKHILAGGKEFTTVADPLLEGLYPEQGLYQVLYLAAQC
LQRKDVSRPRIGYVAKVLSNLAAEIYDPNAVQINRAGSLAVGNIEKEILIEQWRHVWSLV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaaatctatttttagatttggtggaagccctagtaacaacgttgaagattat
gccgtcattactaagtttaagtttcaggaacttgctgcggccacagagaattttgcacaa
gaatcccttttgggggaaggagaatatgggcgtacgttcagaggttgcttaaagagcagt
ggacagaaatcatcttcactggatgtagcaattagacaagttgacgatgaaaccatctgt
accattcacggataccatgacccgtcaatgttttcgtcaattcatatgcgtagccttttg
caccatcctaacatagtcgatctgataggttacagcatcgctgacaaagaccagttgttt
cttgtttataacttcatgccattgggatccttaaaggattatttgcatgatcttccgcgc
aataagaagcctctggactggaatacgagaatgaaaattgcagctggtgcagctaaagga
ataaaatacttgcacgataaatcaactcctcctgttatccttggaaacattaaaccctcc
aacattctcctatgcgcagaatatctcccaaaactgtcagatttcctggggttcaaggag
cgcattccagaacatgatgagtctagtcatacaaggtatttcagccgtcagtgtcatcgc
catgcacctgaatttgttggagattgtaagctcactcaacagtctgacatctacagtttc
agcttagtcttgcttgaactggtttcagggcgcctggcagagattgagcctagtctcatt
ggatgggcaaaacatatactggcaggcggtaaggaattcactacggttgcagatccacta
ctggaaggcctttatccagagcaaggcttgtaccaagttctttatcttgcagctcagtgt
ttacagcgtaaagatgtcagtcggcctcgtataggatatgttgctaaagttctatcaaat
ttggctgctgaaatttacgacccaaatgctgtccaaattaatcgagcaggctcattggca
gttggcaacattgagaaagaaatactaatagagcaatggcgacacgtctggtcacttgta
tga

DBGET integrated database retrieval system