KEGG   Papaver somniferum (opium poppy): 113311682Help
Entry
113311682         CDS       T05758                                 

Definition
(RefSeq) G-type lectin S-receptor-like serine/threonine-protein kinase At1g11300 isoform X1
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
psom  Papaver somniferum (opium poppy)
Brite
KEGG Orthology (KO) [BR:psom00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:psom01001]
    113311682
Enzymes [BR:psom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113311682
Protein kinases [BR:psom01001]
 Serine/threonine kinases: TKL group
  IRAK family
   113311682
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Cellulase APH DUF3403 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 113311682
NCBI-ProteinID: XP_026416273
Position
1
AA seq 724 aa AA seqDB search
MTFHGDMQGEYQLSNGHERENAIRVLTDHRKSYITREDFQYLSQHDINTVKIPVGWWITK
DPNPPAPYVGGSLAALDNAFKWAKEFDIKCIIDLHAAPGSQNGRDHSSSRDDTIDWTKSE
NIQQTLEVVEFLAAKYGNDSSLLGIDLLNDPDVPFDALQKYYKDAYDIVRKYSATAYVIM
CQLNSGDPADLYRVNTGKSNVVLDLHYYNLGSTFENISVQENINYLYNTRKTQMNSLNAS
DGPLLFIGEWVNHFGKGEYSQREYQEYGSAQLDVYRLASFGWAYWTLKNVNNHWSLMWNI
DNNYLQLAAPITAVKKRKAIVYWKIVVPVIVLVVASIMCVLGYIYLFKRNKTQKRERLKA
LQGVLTDLMKSKATYNDTTDNSFEDGKTEGETHELQIFNYTCLSNATNNFCLKNKLGEGG
FGPVYKGQLQNEKEIAVKRLSKYSGQGIEEFKNEVVLISKLQHRNLVKLLGCCIRGEEYM
LIYEYMPKGSLDAYLFDPSKRAKLDWDKRFNIIGGIARGLLYLHRDSRLRVIHRDLKVSN
ILLDENMIPKISDFGMARIFGGDQIIADTNRVVGTFGYMSPEYIMGGTFSDKSDVFSFGV
LILEIISSKRNNSFYNPEKPSNLLLHTWRLWNDGRWSEIVDEALSDLYSPLEVKKCVHIG
LLCVQNRAMDRPTMTEVDLMLISETDRPSPKEPPYISPRSSDKPNSNPTSSSSNHVAITT
VEGR
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgacttttcatggggacatgcaaggagagtaccagctctccaacgggcatgaacgagaa
aatgcaataagagtgcttactgatcatcggaaaagctacattacacgagaggattttcag
tatcttagccaacacgacataaacaccgtcaagattcctgttgggtggtggattaccaaa
gatccaaatccaccagctccttatgttggggggagtttggcagctcttgataatgctttc
aaatgggcaaaggagtttgacataaaatgcataatcgaccttcacgcagctcctggttcc
caaaatggaagggaccacagttctagtcgtgatgatactattgactggacgaaatcagaa
aatatccagcaaacccttgaagttgtagaattcctagctgccaagtatggaaacgattca
tcgcttttggggattgatcttttaaatgatcctgatgttccttttgatgcgttacagaag
tactacaaagacgcatatgacattgtgaggaaatattcagccacagcttatgtaataatg
tgtcagttgaactccggagacccagcagacctttatcgtgttaatactggtaaatcaaac
gtagtactggacttacactactacaatctcggcagtacctttgaaaacataagcgtacag
gagaatatcaattacttgtataataccagaaaaacccaaatgaattccctaaacgcttct
gatggaccattgctgtttattggggaatgggtgaaccattttggaaaaggcgagtactct
cagagggaatatcaagagtatggtagtgcgcagttagatgtgtatcgtttagcttctttt
ggatgggcatattggacactcaagaatgtgaataatcattggtcactcatgtggaacatc
gacaacaattacctccagttagctgctcctataactgcagtcaagaagagaaaggcaata
gtttattggaagatcgtcgtacctgttatcgttttggtggtagctagtatcatgtgcgtg
ttaggatacatttatctgttcaagagaaataaaactcaaaaaagagaaagactgaaagca
ctccaaggggtgttgacagatttgatgaaatccaaggctacctacaacgacactacggat
aactcatttgaagatggtaaaacagaaggagaaacacatgaattgcaaatatttaactac
acttgtttgtccaatgctacaaacaatttctgtttgaaaaataaattgggagaaggaggt
tttgggccagtttataagggtcaattgcaaaacgagaaggaaatagcagtgaaacgactg
tctaaatactctggacagggtattgaagagttcaagaacgaggttgtattgatctccaaa
cttcaacaccgtaaccttgtgaaactattgggttgctgcattcgaggagaagaatacatg
ttaatttatgaatacatgcccaagggtagcctggacgcgtatctattcgatccaagtaag
agagcaaaactagattgggataaacgcttcaatattattggagggattgctcggggtctt
ctttatcttcaccgtgattctcgtttaagagttattcatagagatctcaaagtcagtaac
attttattggatgaaaacatgatccccaaaatttcagattttggaatggcacggatattt
ggtggcgatcaaattattgctgacactaaccgggttgttggtacatttggttacatgtct
ccagaatatataatgggaggaacattttcggacaagtcagatgtctttagtttcggagtg
ttgatattagaaattatcagcagcaagagaaacaacagcttttacaatcctgaaaaacct
tcaaaccttctactacacacttggagactttggaatgatgggagatggtcagagattgta
gacgaggctttgagtgatctctattctccattagaagtgaagaagtgtgtgcatattggt
ctattatgtgttcagaatagagcaatggataggccaacaatgactgaagtagatcttatg
cttatcagtgaaactgatcgtccatctccaaaagaacctccatatatttccccgagatca
tcagataagccaaattcaaacccaactagcagctcgagtaatcatgttgctatcaccaca
gttgaaggtcgatag

DBGET integrated database retrieval system