KEGG   Papaver somniferum (opium poppy): 113312948Help
Entry
113312948         CDS       T05758                                 

Definition
(RefSeq) uncharacterized protein LOC113312948
  KO
K12864  beta-catenin-like protein 1
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    113312948
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:psom03041]
    113312948
Spliceosome [BR:psom03041]
 Complex B
  Other components
   Prp19 complex
    113312948
 Complex C
   Prp19-CDC5 complex
    113312948
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF2555 ANAPC5
Motif
Other DBs
NCBI-GeneID: 113312948
NCBI-ProteinID: XP_026417466
Position
9
AA seq 348 aa AA seqDB search
MSSKENRLQFGNWGAVTVVVNALTSLESPNEEQEEAPLDYEDVEYLVETLFSCLLFLFEC
SENIVRFVDAEGVQLMIKFIQQEEFGYCYGSAIEALATAVKVCQSASEKFVKHALAWNTA
FPPSMDKIPPSVTHVKEKIEAHHISLIASLTGGIAKTEKGNFLKKFEEDDFERITWLMEL
YRGYSEEVEAMANRLEDEEYELCMEKLRYESTVQSIAVILGYLLSEDPTTRNKIENQLTH
HNLKKKHVQDFILVYRDSIGNAGESVESAETVMEESTGSLEENPKQGMELDVKENPDKRM
GLDVKYQTRRSARLMELDVKENPDKRMGLDVKYQLRHSSRLKRRRTSF
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtaaggaaaatagacttcaatttggtaattggggtgctgtaactgttgtagta
aatgctcttacatcccttgaaagtcctaatgaagaacaagaagaagccccgctggattat
gaagacgtagaatacctggtggagactttgtttagttgtttactttttctattcgaatgt
tcggagaatatagtgcgttttgttgatgctgaaggagttcagttaatgattaaatttatt
cagcaagaggaattcggttattgttatggatctgcaattgaggcacttgctactgcagtg
aaagtttgtcaatctgcttctgagaaatttgtgaaacatgctttggcatggaacactgct
ttcccgccttccatggataagattccaccaagtgttacgcacgtgaaagaaaaaatagaa
gcgcatcatatatctctaatcgcatcattaactggtggcattgccaagacggaaaaaggt
aactttttaaaaaagtttgaggaggatgatttcgaaagaatcacctggcttatggagctc
tatagaggatattctgaagaagttgaagcaatggcgaatcgtcttgaagatgaagagtat
gagctctgcatggaaaaactgcgatatgaatccacagttcagtcgattgctgttattctt
ggttatcttttgtccgaggatcctacaacacgaaataaaattgaaaatcaattaactcat
cacaacttaaagaagaaacatgtgcaggattttatcttggtttatcgagacagcattggc
aatgcgggcgaatcagtagaaagtgcagagactgtgatggaggaaagcactggttccctt
gaggaaaatcctaaacaagggatggagctggatgtaaaggaaaatcctgacaagaggatg
gggctggatgtaaagtaccagacgcgacggagtgcaaggctcatggagctggatgtaaag
gaaaatcctgacaagaggatggggctggatgtaaagtaccagctgcgacatagttcaagg
ctcaagcggagacgcacatctttttag

DBGET integrated database retrieval system