KEGG   Papaver somniferum (opium poppy): 113313968Help
Entry
113313968         CDS       T05758                                 

Definition
(RefSeq) L-type lectin-domain containing receptor kinase IV.1-like isoform X1
Organism
psom  Papaver somniferum (opium poppy)
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_legB Pkinase Pkinase_Tyr DUF4448 SKG6 Kinase-like Lectin_leg-like APH
Motif
Other DBs
NCBI-GeneID: 113313968
NCBI-ProteinID: XP_026418524
Position
9
AA seq 689 aa AA seqDB search
MFFKFAILFFFLIANFAASEDLGFVYNGFKNAPNLSLDGVADITENGLLRLTNDTKQRTG
HAFYSDQLRFKIANKNSMVSFSTSFAFAIVSEYRDLSGHGIAFVVAPHREFPGALPSQYL
GLFNESTNGNITNHVVAVELDTIENSEFDINNNHVGIDINDLKSVKSSSAMYFTSNGNSK
NLSLISGQPMLVWIEYDGLKKQLNVTLAPIKIPKPDIPLLSLSQDLSAIVNDSMYVGFSS
STGSVLTSHYILGWSFQINGEAQAIDISRLPKLPRRGPKKKSKMLSIGLPIVVPFFVLVM
VFGVFFIIRRKRKFAELIEDWELNYVTQRFSYKDLYIATKGFKEKEVLGIGGFGKVYKGV
LPGSKIQIAVKKVSHDSRQGIREFIAEIVSIGQLRHRNLVQLLGYCRRQGELLLVYDYMP
NGSLDRFVFRSSNSASSCSSSPPVLNWTQRFQIIKGVASGLFYLHEGWEQVVIHRDIKAS
NVLLDAEMNARVGDFGLARLYDRGTNPQTTNVVGTLGYIAPELTRTGKATTSTDVFGFGA
FLLEVGCGRRPIELQKSETEEEGVILVDWVYSCWSKGGILQTSDPNLKNEYEIEEMELVL
KLGLLCSHNDPKARPTMRQVVQYLEKDAPLPQDEMLALEIGDSNLATNVMVMRGESCEDF
AMSYPGSVDKVYTGSSSSAVDSLLSGSRS
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgttcttcaagtttgccattctatttttctttcttattgcaaattttgcagcttcagaa
gatcttggttttgtttacaatgggtttaaaaatgctcctaatttgagtcttgatggtgta
gcagatatcacagagaatggtctgttaaggctaactaatgacaccaagcagcgaactggt
catgccttctactccgaccaactacggttcaagattgccaacaaaaacagtatggtttca
ttttctacttcttttgcttttgcgattgtttcagaatatcgtgatttaagtggtcatgga
attgcttttgtggttgcacctcatagagagttcccaggagctttaccaagccaatatcta
ggactttttaatgaatccacaaatggaaatattacgaaccatgtcgttgctgtggaacta
gatactattgaaaattctgaattcgatatcaataataaccatgtgggtatcgatatcaat
gatttaaaatctgttaaatcttcatctgctatgtacttcaccagtaatggaaattctaaa
aatctgagtcttataagtgggcaacccatgttagtttggatagaatatgatggtttgaag
aagcagctgaatgtcacattagctcccattaagattcctaagccagatattcccttattg
tctttatctcaagatctttcggccatagttaatgactccatgtatgtcggtttctcttcg
tctactggatcggtattaacatctcattacatattaggatggagttttcagataaacggt
gaagctcaagcaattgatatttctagacttcctaagctccctaggcgaggtcctaagaaa
aaatcaaagatgttatcaattgggttgccgatagttgttccatttttcgtgttggtaatg
gttttcggtgtgttttttatcataagaaggaagaggaaatttgctgagctgattgaagat
tgggagcttaactatgtaacacagagattttcgtacaaagatttatacattgccaccaaa
gggtttaaggagaaagaggtactgggtatcggcggcttcggcaaggtttacaaaggtgta
ctacctggttctaaaattcaaattgctgtgaaaaaagtgtcccatgattcaagacaaggt
ataagagaattcattgctgaaattgtaagtattggccaacttcggcaccgaaatctagta
caattattgggttattgccgacgtcaaggagagctccttttggtctatgattacatgccc
aatggaagtctagacaggtttgtctttcgttcttcaaattcagcctcctcctgttcatcg
tcaccaccagttcttaattggactcaaagatttcaaatcatcaaaggagtagcctcagga
ctattctatctccatgaaggatgggaacaagttgtcattcacagagacatcaaagccagt
aatgttctattagacgctgaaatgaatgcaagagtaggcgatttcggtctggcaagatta
tacgaccgtggaaccaatccgcaaacaacaaatgtggtcggaacattgggctacatagca
cctgaactaactagaaccggaaaagcgacaacgagcactgacgttttcggtttcggagca
ttcttgcttgaagttggttgcggcaggagacccatagagttacaaaaatcagaaacagaa
gaagaaggtgttatattagttgattgggtgtattcttgttggagtaaaggtgggattttg
cagacaagtgatccaaatttgaagaatgaatatgagatagaagagatggaactggtacta
aaattgggattgctatgttcacataatgatccaaaggctagaccaaccatgagacaagtg
gttcagtacttggaaaaagatgcaccattaccacaagatgaaatgttggcccttgaaatt
ggagacagtaatcttgctaccaatgttatggtgatgcgtggggaaagttgtgaagatttt
gccatgtcttatcctggttctgtagataaagtttatactggatcatcttcttctgccgtt
gactcgcttctgtctggttcaagaagttga

DBGET integrated database retrieval system