KEGG   Papaver somniferum (opium poppy): 113317318Help
Entry
113317318         CDS       T05758                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 2-like
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00520  Amino sugar and nucleotide sugar metabolism
psom01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    113317318
Enzymes [BR:psom01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     113317318
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 adh_short KR
Motif
Other DBs
NCBI-GeneID: 113317318
NCBI-ProteinID: XP_026421232
Position
10
AA seq 441 aa AA seqDB search
MASELTYRRHESQAQSDTYLPKPPKPFLPVTRAIRYMLREQRLLFVILGIAIATVIFVLI
PSSSSSRQFTGSYDSIPAQYFPNSDSSTRLSEKFVYEQRSVNSGGKIPLGLRRKGLRIVV
TGGAGFVGSHLVDRLMERGDSVIVVDNFFTGRKENVMHHFGNPRFEMIRHDVVEPLLLEV
DQIYHLACPASPVHYKFNPVKTIKTNVVGTLNMLGLAKRVGARFLLTSTSEVYGDPLQHP
QVETYWGNVNPIGVRSCYDEGKRTAETLAMDYHRGAGVEVRIARIFNTYGPRMCIDDGRV
VSNFVAQALRKEPLTVYGDGKQTRSFQYVSDLVEGLMRLMEGEHVGPFNLGNPGEFTMLE
LAQVVQETIDPNAKIEFRANTEDDPHKRKPDITKAKEQLGWEPKVALRKGLPLMVTDFRQ
RIFGDHKEGSSSTTSGVVSNS
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcatcggaattaacatacagaagacatgaatcacaagcacaatcagatacttattta
ccgaaacccccaaaaccatttttaccagtaactagagctattcgttatatgcttagggaa
caaagactcttatttgtaatacttggaatcgccatcgccacagtaatctttgtcctaatc
ccttcatcatcctcatcaagacagtttacaggaagttatgattcgattccggcacaatac
tttccgaattctgattcttcaactcgtctatcggagaaatttgtttacgagcaaagatct
gtaaattcaggtgggaaaattccgttaggtttgagaaggaaagggttgaggattgttgtt
actggtggtgctggatttgttggtagtcatctagttgatagattgatggaaaggggggat
agtgttatcgttgttgataatttctttacagggaggaaagaaaatgttatgcatcatttt
ggtaatcctagatttgaaatgattagacatgatgttgttgaaccattgttgttggaagtt
gatcagatctatcatttagcttgtcctgcttctcctgttcattacaaattcaatcctgtc
aagactatcaagacaaatgtagttggaacactgaatatgctggggttagctaaaagagtt
ggtgctagatttttgttgacaagtactagtgaagtttatggtgatcctctacagcatcct
caagttgaaacttactggggaaatgtcaatccaattggtgtgaggagttgttatgatgaa
ggaaaaaggactgcagaaactttggcaatggattaccacagaggtgccggtgttgaggtg
agaattgctaggatcttcaacacatatggaccacgaatgtgtatcgatgatggtcgagtt
gtcagtaattttgttgctcaggcactaagaaaagagccattgacagtgtatggtgatgga
aagcaaacaaggagtttccaatacgtttctgatctggtggagggtttgatgaggttaatg
gaaggagaacatgttggtccattcaatctcggtaaccctggtgaattcaccatgcttgaa
cttgctcaggtagtgcaggagactatagaccctaatgcaaagatcgagttcagggccaac
acagaggatgacccacacaagaggaagccagacatcaccaaggccaaggagcaacttggc
tgggagcctaaggtagcactacgcaaagggttgcctctcatggtcactgacttccgtcag
cgtatctttggagaccacaaagaaggaagcagcagcaccaccagtggtgttgtctctaat
tcctaa

DBGET integrated database retrieval system