KEGG   Papaver somniferum (opium poppy): 113317726Help
Entry
113317726         CDS       T05758                                 

Definition
(RefSeq) cysteine-rich receptor-like protein kinase 6
Organism
psom  Papaver somniferum (opium poppy)
Brite
Enzymes [BR:psom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113317726
Protein kinases [BR:psom01001]
 Serine/threonine kinases: TKL group
  IRAK family
   113317726
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Stress-antifung TMEM154 APH Pkinase_fungal Haspin_kinase Rax2 DUF4366 Flavi_NS2B COX6C Orf78 DUF4448
Motif
Other DBs
NCBI-GeneID: 113317726
NCBI-ProteinID: XP_026421651
Position
10
AA seq 560 aa AA seqDB search
MSSYIFRLIASAVIILMIHISSDKVTAQPSFAAQYQCLGDNYTNPSQFQVNLDKVLSSLS
SDITASDRKFFNSSTGNNLDKVYGILLCRGDITQKTCRICAETAISELTERCPNTKEYIT
FYTYCMLRYSDRNIFSVMEEKPEITLQNRESYTNQKVFNDIAAQLMKGLARIATTNENHN
ETLLFATGEIDYSSVDKIYGLVQCTTDISTSDCNDCLMSAIGNISDCCYGRKGGIVLKPS
CNIRYEPYPFSDYKQETNPGPLPSSPPPKQNVTATTGDTEKDNKSSSNIVLIVAIPLAIA
LVLISTALVYFYLKKKKKKAYNSIDEPDDMDDITRIESLRFDLDTIKAATGNFSNDNKLG
KGGFGYVYKGTLSNGQEIAVKRLSINSEQGKKEFRTEVGLLVKLQHRNLVRLLGFCLEGE
EKLLIYEFVPNGSLDQIIFDPSKAANLNWETRYKIIGGIAKGLLYLHEDSRLRIIHRDLK
AANVLLDEENNAKIADFGMAKLFDLDLTQGNSSSAVGTFGYIAPEYVLHGQFSTKSDVYS
FGILLLEIITGRRINQFYES
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcttacattttccgactgatcgcttctgcagtgatcattctcatgatacacatt
agtagcgacaaagtaactgcacaaccctcatttgcagcccagtaccaatgtctaggagat
aattacacaaatcccagccaatttcaggtgaatctagacaaagttctctcttctctgtct
tccgacatcacggcaagtgatcgaaagtttttcaacagcagcactggcaataacctggat
aaagtatatggtatcttactctgtagaggagatattacacaaaaaacctgcaggatttgt
gcggaaactgcaatttcagagttgacagaacgttgtccaaacacgaaagagtacattaca
ttttacacttactgcatgctaagatactcagacagaaatatattttctgttatggaggaa
aagccagagatcactttgcaaaaccgagagagttacaccaaccagaaggtatttaacgat
attgcagcacagttaatgaaaggtctagcaagaattgctactacaaatgaaaaccacaat
gagactttactttttgccactggagaaatagattattcttcagtagataaaatttatggc
ttggttcaatgtactacggatatatctacaagcgactgcaatgattgcctaatgagtgca
attggtaatatcagtgattgttgttacgggaggaaaggtgggatagttcttaaacctagt
tgtaatataaggtatgagccgtatcctttctctgactacaaacaagaaactaatccaggt
ccccttccttcaagtcctcctccaaaacaaaatgtgactgcaacaacaggagatactgaa
aaagacaataagtcctccagcaatatagttcttattgtggccattcctttagctattgct
ctcgtactcatctccacagcattagtatacttctatttgaagaagaagaagaagaaggcc
tacaactcgattgatgaacctgatgatatggatgacattacaaggatagagtcattgcgg
tttgacttagacacaataaaagctgctactggaaatttctctaatgataataagcttggg
aaaggaggatttggttatgtttacaagggtacgttatcaaatggacaagaaatagccgta
aagcggctatctatcaactctgaacagggtaaaaaagaatttaggactgaggttggttta
ttggtcaagcttcaacacaggaatcttgttagactccttggtttctgcttggagggagaa
gaaaagctgcttatctatgagtttgtgcccaacggaagcctcgaccaaattatttttgac
ccctcgaaagcagcaaatttgaattgggaaacacgttataaaataattggagggatcgct
aaaggcctactctatcttcatgaagattctcggttaagaattattcatagagatctcaaa
gctgccaatgtgttgttagatgaagagaacaacgccaaaattgcagattttggtatggca
aagctgtttgacttggacctaactcaaggaaacagcagtagcgctgtgggaacattcgga
tacattgcaccagaatatgtattgcatgggcagttctcgacaaaatcagatgtatatagt
tttggtatcttactactcgagataataaccggcaggaggatcaatcagttctacgaatca
tga

DBGET integrated database retrieval system