KEGG   Papaver somniferum (opium poppy): 113318220Help
Entry
113318220         CDS       T05758                                 

Definition
(RefSeq) isocitrate dehydrogenase [NADP]-like
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00020  Citrate cycle (TCA cycle)
psom00480  Glutathione metabolism
psom01100  Metabolic pathways
psom01110  Biosynthesis of secondary metabolites
psom01200  Carbon metabolism
psom01210  2-Oxocarboxylic acid metabolism
psom01230  Biosynthesis of amino acids
psom04146  Peroxisome
Module
psom_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    113318220
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    113318220
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    113318220
Enzymes [BR:psom01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     113318220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 113318220
NCBI-ProteinID: XP_026422142
Position
10
AA seq 479 aa AA seqDB search
MLSLRLRAMAGATLSTPSSLSFKNPSFSTKRFPNPSPLNGVFFRNQNKTQDCFRESSIRC
FVSASAVGRIKVQNPIVEMDGDEMTRVIWKMIKDKLILPYLDLDIKYYDLGILNRDATDD
NVTVESAEATLKYNVAVKCATITPDEARVKEFGLKAMWRSPNGTIRNILNGTVFREPIMC
QNIPRIVTGWKKAICIGRHAFGDQYRAADLVVKGPGKLKMVFSPEDGSTLQELNVYDFKG
PGIALAMYNVDESIRAFAESAMAMALTKKWPLYLSTKNTILKRYDGRFKDIFQEVYETNW
KEKFEENSIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMSSVL
LSSDGKTLEAEAAHGTVTRHFRLHQKGQETSTNSIASIFAWTRGLEHRAKLDHHEKLLDF
VSKLEAACIETVETGKMTKDLALLSHGPKVSRDLYLNTEEFIDAVAENLDVKLRAPVLL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgttgagtcttcgtctgcgcgccatggctggcgcaactctttctaccccttcttcccta
agctttaaaaaccctagtttctcaaccaaaagattcccgaatccatctccactcaatgga
gttttcttcagaaaccaaaataaaacccaagattgtttccgcgaatcatctattcggtgt
ttcgtttctgcttccgctgtgggtagaatcaaagttcagaatcctatcgttgaaatggac
ggtgatgaaatgactagagtaatttggaagatgattaaagataagcttatacttccttac
ttggatttggatattaagtactatgatctaggtatactgaatcgtgatgctactgatgat
aatgttacagttgaaagtgccgaagctactctcaagtacaatgtagctgtcaaatgtgca
acgattactcccgatgaagctagagtcaaagagtttggcctgaaagctatgtggagaagc
cccaatgggacgatacggaacattttgaatggaactgtttttcgtgaacccatcatgtgc
cagaatatccctaggattgtcactggttggaaaaaagccatttgcattggtaggcatgcc
tttggagaccagtatcgcgcggctgatttggtggttaaaggaccaggaaagcttaaaatg
gtcttctccccagaagatggaagcactctgcaagagcttaatgtttatgatttcaagggc
cctggaattgctctggcaatgtacaacgttgacgagtcaattcgagcttttgctgagtcg
gcaatggcaatggcgcttacaaagaaatggcctctctacttgagcaccaaaaacactatc
ctaaagagatacgatggaaggtttaaggatatcttccaggaggtatatgaaactaactgg
aaggaaaagtttgaagagaattccatatggtatgagcatcgtctaattgatgacatggtg
gcatatgcactaaaaagcgaaggtggatatgtgtgggcatgcaaaaattatgatggagat
gtccagagtgatttcctcgctcaaggatttggttctcttggcttgatgagttctgtattg
ttatcctcggatggaaagacattagaagctgaggctgctcatgggactgtgactcggcat
tttcggttacaccagaagggacaagaaactagtacaaacagcattgcatccatatttgca
tggacaaggggtcttgaacatagggccaaactagatcatcatgagaagttattggatttt
gtctcgaagttagaggcagcatgcatcgaaacagttgaaacagggaaaatgacgaaggat
cttgcccttctgtctcatggacccaaggtatcaagagacctatatttgaacaccgaagaa
ttcattgatgccgttgcagagaatcttgacgtgaagcttagggccccagtacttttgtga

DBGET integrated database retrieval system