KEGG   Papaver somniferum (opium poppy): 113318867Help
Entry
113318867         CDS       T05758                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain 1, chloroplastic-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00630  Glyoxylate and dicarboxylate metabolism
psom00710  Carbon fixation in photosynthetic organisms
psom01100  Metabolic pathways
psom01110  Biosynthesis of secondary metabolites
psom01200  Carbon metabolism
Module
psom_M00165  Reductive pentose phosphate cycle (Calvin cycle)
psom_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
psom_M00532  Photorespiration
psom_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    113318867
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    113318867
Enzymes [BR:psom01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     113318867
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 113318867
NCBI-ProteinID: XP_026422933
Position
1
AA seq 184 aa AA seqDB search
MASSVISSAAVASVRSSAPAQANMVAPFSGLKSVAAFPVTRKSNDITSVASNGGRVNCMQ
VWPPTGLKKFETLSYLPPLTVEQLSKEVDYLLRNGWVPCLEFDARGFVYREHGNTPGYYD
GRYWTMWKLPMFGCTDASQVIKELEEAKAAYPGSFIRIIGFDNVRQVQCVSFIAYKPEST
SYEQ
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcagtgatttcctctgctgcagtcgcctccgtgaggagctctgctcccgct
caagctaacatggttgcaccattcagtggcttgaaatccgttgctgcattcccagttacc
cgcaaatcaaacgacatcacctccgttgccagcaacggtggaagagttaactgcatgcag
gtatggccaccaactggtttgaagaagtttgagaccctctcataccttcccccattgacc
gtcgagcaactatcaaaggaagttgactaccttctccgtaatggatgggttccctgtttg
gaattcgacgccagaggattcgtctacagagaacacggtaacacccctggatactacgat
ggtcgttactggacaatgtggaagctacccatgttcggttgtaccgacgcttcccaggtt
atcaaggagctagaagaggccaaggctgcatacccaggctctttcatcagaatcatcgga
ttcgacaacgttcgtcaagtacaatgtgttagtttcatcgcatacaagcccgagagtacc
agctacgaacagtaa

DBGET integrated database retrieval system