KEGG   Papaver somniferum (opium poppy): 113318882Help
Entry
113318882         CDS       T05758                                 

Definition
(RefSeq) LRR receptor-like serine/threonine-protein kinase FEI 1
Organism
psom  Papaver somniferum (opium poppy)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr LRR_8 LRRNT_2 LRR_4 LRR_1 Pkinase_fungal APH Kinase-like
Motif
Other DBs
NCBI-GeneID: 113318882
NCBI-ProteinID: XP_026422948
Position
10
AA seq 602 aa AA seqDB search
MGFLALVISLLTFILTNLLSSNSVALTQDGKALLEIKGFLNDSRRLLDNWKYTDEFPCNW
TGITCHKNDNLVSSINLANMQLGGITSPSIGKLRRLQRLALHQNSLHGIIPAEISNCLEL
RALYLRSNYLQGSIPPELGNLTNLIILDISSNSLEGSIPPSIGRLTRLRFLNLSTNFFSG
AIPNVGVLVGFGNKSFIGNLDLCGLQLQKPCLGSLGFPAVLPHTEKDETAVPSKLFSRYL
NGVLIAAMSTMGLALLVLLSFLWISLLSKKERTAKKYREVNKQVDPDPSARLITFHGDLP
YSSCEIIEKLESLDEEHVVGSGGFGTVYRMVMNDCSTFAVKRIDRSREGCDEVFERELEI
LGSINHINLVNLRGYCRLPSAKLLIYDYLALGSLDDLLHEYGEEEQVLNWNSRLRIALGS
ARGLAYLHHDCCPRIVHRDIKSSNILLDENLEPRVSDFGLAKLLVDEDAHVTTVVAGTFG
YLAPEYLQSGRATEKSDVYSFGVLLLELVTGKRPTDSTFVKRGLNVVGWMNTMVGENRLE
DIVDKRCTDANVDTLEALLEIAAKCTDANTDDRPCMNQALQMLEEVMSPCPSEFYESQSD
YC
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgggttttttggctctagtcatttcattactgacatttatcttaacaaaccttttgagt
tctaactctgtagctctaactcaagatggtaaggcattgttggaaatcaaagggtttttg
aatgacagtagaagattacttgataattggaaatatactgatgaatttccttgtaactgg
actggaatcacttgtcataagaatgacaatcttgttagttctataaatttagcaaatatg
caacttggagggataacatctcctagtattgggaagcttaggagattgcagagattggca
cttcatcagaatagcttgcatggaattattcctgctgaaatttctaattgtttggaactc
agggctttgtatctaaggtctaattatcttcaaggaagtattccgccagagcttggaaat
cttacaaatcttatcatattggatatatcgagcaattcacttgagggatccatacctccc
tccattggtcgtcttactcggttgcgctttttaaacttgtcaactaactttttctccggt
gcaatcccaaatgttggcgttcttgtcggttttgggaacaagtcgttcattggaaattta
gacctttgtggcctgcaacttcagaagccatgtcttggatcactaggtttccctgcagtc
ttaccacatacagaaaaagatgaaacagcagttccttctaagctattttctcgttatctc
aatggagttcttattgctgcaatgtctacaatgggtcttgcacttcttgtgctgctaagt
ttcctatggatttctttactatcaaagaaggaaagaacagcaaagaagtacagggaagtc
aataaacaagttgatcccgacccaagtgcaaggcttattactttccatggcgaccttcca
tattcctcgtgtgagatcatagaaaagcttgagtcactcgatgaagaacatgtagtgggg
tctggaggatttggcactgtatacagaatggttatgaatgattgcagtacatttgctgtt
aaaaggatagataggagtcgagaaggatgtgatgaagttttcgagagagaacttgagatt
ttgggcagtatcaatcacataaaccttgtcaatcttcgaggttattgtagacttccttct
gccaagcttcttatctatgattatctggctttgggtagtctagatgatttacttcatgaa
tatggtgaagaagaacaggtcttgaattggaattctcgtttaaggatagcccttggttca
gcccgaggactggcttacttacaccatgattgttgtccgcggatagttcaccgcgacata
aaatctagcaacatactcctcgatgaaaacctagaaccacgagtgtctgattttggcctt
gctaagcttttggttgatgaggacgcacatgtcaccactgttgttgctggaacatttggt
tacttagctccagaatatctgcaaagtggacgggcaactgagaagtcggatgtttatagc
tttggagttctcttgttagagcttgtaactggaaagagacctactgattctacctttgta
aagaggggattaaatgttgtcggttggatgaacactatggtgggtgagaacaggttagag
gatatagtggataaaagatgtactgatgccaatgtggacactttagaagcgcttcttgag
attgctgcaaaatgcactgatgccaatacagatgaccgcccttgcatgaatcaagctcta
cagatgctagaagaggttatgtcaccttgtcctagtgaattctatgaatctcaatcagat
tattgttaa

DBGET integrated database retrieval system