KEGG   Papaver somniferum (opium poppy): 113321649Help
Entry
113321649         CDS       T05758                                 

Definition
(RefSeq) cell division protein FtsZ homolog 2-2, chloroplastic-like isoform X1
  KO
K03531  cell division protein FtsZ
Organism
psom  Papaver somniferum (opium poppy)
Brite
KEGG Orthology (KO) [BR:psom00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:psom03036]
    113321649
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:psom04812]
    113321649
   02048 Prokaryotic defense system [BR:psom02048]
    113321649
Chromosome and associated proteins [BR:psom03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    113321649
Cytoskeleton proteins [BR:psom04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   113321649
Prokaryotic defense system [BR:psom02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    113321649
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FtsZ_C Tubulin
Motif
Other DBs
NCBI-GeneID: 113321649
NCBI-ProteinID: XP_026425344
Position
11
AA seq 385 aa AA seqDB search
MLRGNERIDTVISPKNDGSIGKITESLIDSSIPEENYSTAKIKVIGGGGGGSNAVNRMIE
SNMKGIEFWILNTDIQAMRMSPVFPDNRLQIGQELTRGLGAGGNPDIGMNAAKESREAIE
EALYGSDMVFVTAGMGGGTGTGGAPFSFEGRRRAVQAQEGTAALRDNVDTLIVIPNDKLL
TAVTQNTPVTEAFNLADDILCQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGT
ATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGSDLTLYEVNAAAEVIYDLVDPSA
NLIFGAVIDPSLSGQVSITLIATGFKRQEEAEGRPPVQGKLQGTQLPNGDINLGGMNRRP
SSFNEGSSVEIPEFLKKKGRRFPRA
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgttgagaggtaatgaaagaattgacacggttattagtccgaaaaatgatgggtcaatt
gggaaaattactgagagtttgattgattcgtctatcccggaggagaattacagtacagct
aagattaaagttattggtggtggtggtggtgggtcgaatgctgttaatagaatgattgag
agtaatatgaaaggtattgagttttggattcttaacacggatattcaagctatgagaatg
tcgcctgtgtttccggataaccgactgcaaattggtcaggagttaactaggggtcttggt
gctggtgggaaccctgatattggtatgaatgctgctaaagaaagtagagaagctatagaa
gaggcactttatggttctgacatggtatttgttacggctggaatgggtggaggaactggt
actggtggggcaccgttctcttttgagggccgaagacgagcagttcaagcacaggaagga
actgctgctttgagagacaatgttgacactctgattgtcattccaaatgataagctgttg
actgctgtcacccagaatacccctgtaacagaagcattcaacttggctgatgatattctt
tgccaaggtgttcgtggtatctctgacataattacgattccaggccttgtaaatgttgat
tttgccgatgtccgagccattatggctaatgctggctcatctttaatggggataggaact
gcaacaggcaagaccagggcaagagatgctgcattaaatgccatccaatcacctttacta
gatattggcatagaaagggctactggaatcgtgtggaacatcactggtggaagtgattta
actttgtacgaggtaaatgctgcagcagaggtgatatatgaccttgttgatccaagtgca
aatttaatatttggagcagttatagatccatcactcagtggtcaagtaagtataactctg
attgccactggattcaaacggcaagaagaagctgaaggaaggcctcctgttcagggtaaa
ttgcagggaactcagttaccaaacggggacatcaaccttggcggaatgaatcgacgacct
tcctctttcaacgaaggcagctcagtggagatccctgaattcctgaagaaaaaaggccga
cgctttcccagagcttga

DBGET integrated database retrieval system