KEGG   Papaver somniferum (opium poppy): 113322176Help
Entry
113322176         CDS       T05758                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C-like
  KO
K03252  translation initiation factor 3 subunit C
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom03013  RNA transport
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    113322176
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:psom03012]
    113322176
Translation factors [BR:psom03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    113322176
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI CSN8_PSD8_EIF3K
Motif
Other DBs
NCBI-GeneID: 113322176
NCBI-ProteinID: XP_026425999
Position
11
AA seq 927 aa AA seqDB search
MASRFFGGGDSDTEDDDSMIGSEIGSDIERGEEATGKQLKSKYLTEGNGSDDNTDDEIRV
VKSAKDKRLDEIKATIEQLKNGMKINDWVSIQENFDKMNKQLEKVIRATEAIKAPTLYIR
ALVMLEDFLVEALANKEAKKKMSSTNAKGLNSMKQKLKKKNKEYEYLINKFRENPVDSEP
ETKEDEEPEDDESGTDTEDMSEPELEEERGSDDDNDQPWVDPTKKKNPFTKPFEKDPSEI
SWDIVDKKLKECVAARGRKGTGRVEQVEQLTFLTKVAKTPAQKLEILFSVVSAQFDVNPS
LSGHMPVTVWKKCAQNMLTILDILEQYPNIVVSDSEEPEENESQKGADYKGTIRVWGNLV
AFLERMDGEFMKSLQTIDPHTREYVDRMRDEPIFFVLAQNVQNYLEHVGDFRAAAKVAVK
LVELVYYKPQEVYDAMRELAGKTEIGGNVETEAGDEAQVVKQSSGPPAFVATPELVPRRP
TFPENCRTMMDALVSLIYNHGDERTKARAMLCDIYNHAIMDEYASSRDLLLMSHLQDGIQ
HMDILTQILFNRTMAQLGLCAFRAGLITEAHSCLSELYAGGRVRELIAQGASQSRYHEKT
AEQEKLERRRQVPYHMHINLELLESVHLICAMLLEVPNMAANSHDARARVVSKNFRRLLE
VSERHTFTGPPENVRDHVMAATRSLRKGDFQKAFDVIKSLDVWKLLRNQVSILEMLKTKF
KEEALRTYLFTFSSSYNSLSLDQLTAMFDLSEAQVHSIVSKMIIVEELNASWDQPTKCIM
FHDVKHTRLQALAFQLTEKIAILADSNERAFEAKSGGGLDGLPQRRRDGGQDYAGAVAGR
WQENFSQGRQGGYGGRSGYGGGRQFSSGGRGSFRDQRSGGQARGGGYSTGYQSNRYQDGR
TSYQTSSGARGDASARMVSLNRTGRAY
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaagattttttggaggtggtgatagtgacaccgaagatgatgatagtatgata
ggatcagagattggttctgatatcgaacgtggagaggaggccactggaaagcaactaaaa
agcaaatacctaactgaaggtaatggaagtgacgacaacactgacgatgagataagagtg
gttaaatctgctaaagataagcgtctcgatgagattaaggcaacgattgagcagctaaag
aatggcatgaagattaatgactgggttagcattcaagagaactttgataagatgaacaag
cagcttgagaaggttattagagcaactgaagctattaaggctccaactctttacatcaga
gcccttgtcatgttggaggattttttggttgaggcattggctaacaaggaagcaaaaaag
aaaatgagcagcactaatgcaaaggggttgaattccatgaaacagaaactgaagaagaag
aataaggaatatgaatatcttattaacaaattcagggagaatcctgtagatagtgagccc
gaaaccaaggaggatgaagagccagaggatgatgaatcgggtaccgacaccgaggacatg
tcagagccagaattagaagaggaacgcggctcggatgatgataatgaccaaccatgggtc
gatccgaccaagaagaagaacccttttacaaagccttttgagaaagaccccagtgaaatc
tcatgggatatagtcgacaagaaactgaaagaatgtgtagctgctagggggcgtaagggt
actggtcgagttgagcaggttgagcaactcaccttcttgacaaaggttgctaagactcct
gcccagaagcttgagatactcttcagtgttgtctctgctcaatttgatgtgaaccctagt
cttagcgggcatatgcctgtaactgtgtggaagaaatgtgcgcagaacatgctcactata
cttgatatacttgagcagtatccaaatatcgtcgttagtgactccgaggagcccgaggaa
aatgagtcccaaaagggtgcagattataaggggaccattcgggtttgggggaacttggtc
gctttccttgagcgtatggatggcgagttcatgaagagcttgcagaccatcgatccccac
acacgagaatatgtggatagaatgagggatgagcccattttctttgttcttgcccaaaat
gttcagaattatttagaacatgttggggacttcagggcagcggcaaaggttgctgtaaag
ctggttgagcttgtatactacaagcctcaagaggtttacgatgcaatgagggagctcgct
ggaaaaacagagattggaggaaatgttgaaactgaggcaggagatgaggctcaagtggtc
aagcaaagtagtggcccaccagcttttgttgctactccggaacttgtgccacgaagaccc
acttttccggagaactgccggacaatgatggatgcactagtctctcttatctacaatcat
ggggatgagcgcactaaagctcgtgcaatgctttgtgatatatataatcacgccatcatg
gatgagtatgcaagttccagggacttactattaatgagtcacttgcaagatgggattcag
cacatggatatcttaactcagatacttttcaatagaactatggcccaactcggtttgtgt
gcatttagagctggattgattactgaggcacacagttgcctttcagaactctatgcaggt
ggaagagtgagggagttgattgcacaaggcgcatcacagagccgctatcatgagaagacg
gcagagcaggaaaagttggaacgcagaaggcaggtgccataccatatgcacattaatctt
gagcttctggagtctgtccatcttatatgtgccatgctcctagaagtccccaacatggct
gccaacagtcatgatgccagagctagagtcgttagtaagaatttccgcagactacttgag
gtcagtgagagacataccttcacaggacctccagagaatgtgcgagaccatgtgatggca
gcaaccaggtccctacgcaaaggagatttccaaaaagcttttgatgtcattaagtcgctt
gatgtgtggaagctcctcagaaaccaagtaagcatccttgagatgctcaagacaaaattc
aaggaggaggcccttagaacctacttgttcaccttctcttcatcttacaactccctgagc
ttggaccagcttacagccatgtttgatctgtccgaagcccaggtacacagcattgtaagc
aagatgatcattgtggaggaattgaatgcaagctgggaccagcctacgaagtgcatcatg
ttccatgatgtaaagcacacaagattgcaggctctggcattccagctgacagagaaaatc
gccatccttgcagatagcaatgagagggcatttgaggcgaaatcaggtggagggcttgat
gggcttccccaaagacgcagggatgggggccaggattatgctggagctgttgcaggccgg
tggcaagagaacttctctcagggtaggcaaggtgggtatggtggacgttcaggatatggt
ggtgggcgtcagttctcatctggaggaagaggatctttcagggatcaaagaagtggaggc
caagctcgcggaggtggttactctactggttaccaaagcaaccgttatcaggatgggaga
acttcttatcagacaagttcaggggcaagaggagatgcttcagcccgcatggtcagtctg
aacagaacaggtcgtgcttattaa

DBGET integrated database retrieval system