KEGG   Papaver somniferum (opium poppy): 113322658Help
Entry
113322658         CDS       T05758                                 

Definition
(RefSeq) luminal-binding protein 5-like
  KO
K09490  heat shock 70kDa protein 5
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom03060  Protein export
psom04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    113322658
   04141 Protein processing in endoplasmic reticulum
    113322658
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:psom03110]
    113322658
   04131 Membrane trafficking [BR:psom04131]
    113322658
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psom04147]
    113322658
Chaperones and folding catalysts [BR:psom03110]
 Heat shock proteins
  HSP70 / DNAK
   113322658
Membrane trafficking [BR:psom04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    113322658
Exosome [BR:psom04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113322658
  Exosomal proteins of other body fluids (saliva and urine)
   113322658
  Exosomal proteins of colorectal cancer cells
   113322658
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Hydantoinase_A FtsA Radial_spoke_3 FGGY_C
Motif
Other DBs
NCBI-GeneID: 113322658
NCBI-ProteinID: XP_026426578
Position
1
AA seq 671 aa AA seqDB search
MAISNRGFKSALIVFSVLFSAYLCVICTAKEEATASKLGTVIGIDLGTTYSCVGVYKNGH
VEIIANDQGNRITPSWVAFTPGERLLGEAAKNQHAANPMGTIFDIKRLIGRKFDDKEVQR
DMKLLPYKIVNKEGKPYVDVKLKDGETKVFSPEEISAMILTKMKETAEAFLGKKVKDAVI
TVPAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYGLDKKTGEKNILVFDLGGGTF
DVSILTIDNGVFEVLSTNGDTHLGGEDFDHRVMDYFIKLIKKKHGKDISKDNRALGKLRR
ECERAKRALSNQHQVRVEIESLYDGLDFSEPLTRARFEELNNDLFKKTMGPVKKAMADAG
LEKKQIDEIVLVGGSTRIPKVQELLKEYFDGKEPSKGVNPDEAVAYGAAVQGGILSGEGG
DETKDILLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTVSIQVFEG
ERSLTKDCRELGKFDLSGLAPAPRGTPQIEVTFEVDANGILNVKAEDKASGRAEKITITN
EKGRLSQEEIDRMVKEAEDFAEEDKKVKEKIDARNSMESYVYNMKTQINDKDKLADKLES
DEKEKIEAAVKEALEWLDENQSAEKEDYDEKLKEVEAVCNPIITAVYQRSGGAPGAGSTD
DAEDNEDHDEL
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggcgatatcaaatcgcggtttcaaatctgcactaatcgtattctcagtcctcttttcc
gcttatttatgtgtaatttgtactgcgaaagaggaagcaacagcatcaaaattaggaaca
gtaattggtattgatcttggtacaacctattcctgtgttggtgtttacaaaaacggacat
gttgaaatcatagctaatgaccagggtaatcgtattactccttcatgggttgcgtttact
cctggtgaacgtttgttgggtgaggctgcaaagaatcaacatgcagctaatccaatggga
actatctttgacatcaagagacttatcggaagaaagtttgatgataaagaggtacagaga
gatatgaaactcttaccatacaagattgtcaacaaggaaggaaagccatatgttgatgtt
aaacttaaggatggtgagactaaggttttcagtcctgaggaaattagtgctatgattctg
accaagatgaaggaaacagctgaagcattcttaggaaaaaaggttaaggatgccgtcatt
actgttcccgcatacttcaatgatgctcagagacaggctaccaaggatgctggtgtgatt
gctggattaaatgtagcaagaatcatcaacgagcctaccgcagcagctatcgcttatggt
ttggacaaaaagactggagagaagaacatccttgtttttgatcttggtggtggtactttt
gatgtcagtatcttgactattgataatggagttttcgaggttctttcaaccaacggagac
actcatttgggaggtgaggactttgaccacagagtcatggactacttcattaaattgatc
aagaagaagcatggaaaggacatcagcaaggacaacagggctcttggaaagcttaggagg
gagtgtgaacgtgctaagagagctttgagtaaccaacatcaagtccgtgtcgagattgaa
tctctatacgacggtttggatttctctgagccacttacccgtgctcgtttcgaagaattg
aacaatgatttattcaagaagaccatgggaccagtgaagaaagctatggctgatgctgga
ctagagaagaagcaaattgatgagattgtacttgttggtggaagtaccaggattcccaag
gttcaagagctccttaaggaatactttgacggcaaagaacccagcaaaggtgtcaaccca
gatgaggctgttgcttatggtgctgctgtacaaggaggtatcttgagcggagagggtggt
gatgaaaccaaagatattcttctattggatgtcgccccacttactcttggtattgagact
gttggaggtgtgatgaccaagttgatcccaagaaacacagttatcccaaccaagaaatct
caagtttttaccacttaccaggatcagcagaccactgtctctattcaggttttcgaaggt
gaaaggagtcttacaaaggactgcagggagcttggaaagtttgatctttctggacttgct
ccagctccaaggggaacccctcagattgaagtcacttttgaagttgacgccaatggtatt
ttgaacgtgaaagctgaggacaaggcaagtggaagggcagagaagatcactatcaccaat
gagaagggtcgtttgagccaggaggagattgaccgtatggttaaagaggcagaggatttc
gccgaggaagacaagaaggtcaaggaaaagattgatgccagaaacagcatggagagttac
gtctacaacatgaagactcagatcaatgacaaggacaagcttgcagacaagctagagtct
gatgagaaagagaagattgaggcagcagtaaaggaggccctggaatggcttgatgagaac
cagtctgccgagaaggaagactatgatgagaaactcaaggaagtcgaagccgtttgcaac
ccaattatcaccgctgtctaccaaagatctggtggagctcctggtgctggatcaaccgat
gatgcagaagacaacgaagaccatgatgagctttag

KEGG   Papaver somniferum (opium poppy): 113329283Help
Entry
113329283         CDS       T05758                                 

Definition
(RefSeq) luminal-binding protein 5-like
  KO
K09490  heat shock 70kDa protein 5
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom03060  Protein export
psom04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    113329283
   04141 Protein processing in endoplasmic reticulum
    113329283
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:psom03110]
    113329283
   04131 Membrane trafficking [BR:psom04131]
    113329283
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psom04147]
    113329283
Chaperones and folding catalysts [BR:psom03110]
 Heat shock proteins
  HSP70 / DNAK
   113329283
Membrane trafficking [BR:psom04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    113329283
Exosome [BR:psom04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113329283
  Exosomal proteins of other body fluids (saliva and urine)
   113329283
  Exosomal proteins of colorectal cancer cells
   113329283
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Hydantoinase_A DDR FtsA Radial_spoke_3 FGGY_C
Motif
Other DBs
NCBI-GeneID: 113329283
NCBI-ProteinID: XP_026432026
Position
Unknown
AA seq 670 aa AA seqDB search
MDVSSSKNRGLSSSSLKVFLILLCSVLCVFSVVAKEEATAKFGTVIGIDLGTTYSCVGVY
KNGHVEIIANDQGNRITPSWVGFTSLGERLIGEAAKNQAPANPERTFFDSKRLIGRLFGD
KDVQKDIKLLPYNVVNKDGKPYVGVTLKDGEAKVFSPEEISAMVLTKMKETAEAFLGKKV
KDAVITVPAYFNDAQRQATKDAGVIAGLNVVRIINEPTAAAIAYGLHKKGEEKNILVFDL
GGGTFDVSILNIDNGVFEVLSTNGDTHLGGEDFDHRVMDYFIKLIKKKHGKDFSNDNKAL
GKLRRECERAKRALSNQHSVRVEIESLYEGLDFSESLTRARFEELNTDLFKKTMGPVKKA
MADAGLEKNQIDEIVLVGGSTRIPKVQQLIKEYFNGKEPNKGVNPDEAVAYGAAVQGGIL
SGEGGDETKDVLLLDVAPLTLGIETVGGVMAKVIPRNTGIPTKRSQFFTTYQDQQTIVSI
HVFEGERSLTKDCRELGKFDLSGLAPATRGIPQIEVTFEVDANGILNVRAEDKASGKAEK
ITITTEKDRLSQEEIDRMVKEAEDFAEEDKKVKENIEARNSLESYVYNMKAQVNDNDKLA
DKLESDEKEKIEEAVKEALEWLDENQAADKEDYDEKFKEVEAVCNPIITAVYQRSGGAPG
AGSQEDADEL
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggacgtgtcttcttcgaaaaatcgcgggttgtcatcatcttcattaaaggtattctta
atcctcttatgcagtgttttatgtgtattttccgtagtagccaaagaggaagcaacggca
aagttcggaacagtgattggtattgatcttggtacgacctattcatgtgttggtgtttac
aagaacggacatgtcgaaatcatagcaaacgaccaaggtaaccgtattacaccatcttgg
gttggttttacttctttaggagaacgtttgatcggtgaggctgcaaagaatcaagcacct
gcgaatcccgagagaactttcttcgatagcaaaagacttatcggaagattgtttggcgat
aaagatgtacaaaaagatataaaactcttaccgtataacgtcgtgaataaagatggaaag
ccttatgttggggtaacgctcaaggatggggaagctaaagttttcagccctgaggaaatc
agtgcgatggtactaactaagatgaaggagacagctgaagcgtttcttggaaagaaagtt
aaggatgccgttatcactgtaccagcgtatttcaatgatgctcagagacaggctacaaag
gatgctggtgtgattgctggattgaatgtagtaagaatcatcaacgagccaactgcagct
gcaatcgcctatggtttgcataaaaaaggtgaagagaagaacatccttgtttttgacctt
ggtggtggtacattcgacgtcagcatcttgaatattgataatggggtttttgaggttctt
tcgacaaacggtgacacgcatttgggaggtgaggactttgatcacagggttatggattac
ttcattaaattgatcaagaagaagcatggaaaggactttagcaacgacaacaaggctctt
gggaagctaaggagggagtgtgaacgtgctaagagagcgttgagtaaccaacattcggtg
agagttgagattgagtctctatacgaaggcttggatttctctgaatcacttacccgtgct
cgtttcgaagaattgaacactgatctattcaagaagaccatgggacctgtgaagaaggct
atggctgatgctggactagaaaaaaaccagattgatgagattgtccttgttggtggaagt
accaggattcccaaggttcaacagctcattaaagaatacttcaacggcaaagagccaaac
aaaggtgtcaaccctgatgaggctgttgcttacggtgctgctgtacaaggaggtatcttg
agcggagagggtggtgatgaaaccaaagatgttcttcttttggatgtcgcaccacttact
ctcggtatcgaaaccgttggcggtgtgatggccaaggttatccctaggaacacaggtatc
ccaaccaagcgatctcaattttttaccacttaccaggatcagcagaccattgtctccata
catgttttcgaaggtgaaagaagtctcacaaaagactgcagggaacttggaaagtttgat
ctttctggacttgctccagctacaaggggaatccctcagattgaagtcacattcgaggtt
gatgccaatggtattcttaatgtaagagctgaagacaaagcaagtggaaaggcagagaag
atcactatcacaactgaaaaggatcgcttgagccaagaggagattgaccgaatggttaaa
gaagcggaggatttcgcagaggaagataagaaggtcaaggaaaatatcgaggcgagaaac
agcttggagagttatgtgtacaacatgaaggcgcaggtcaatgataatgacaagcttgca
gacaagctggaatcagatgagaaagagaagattgaggaagcagtaaaggaggctcttgaa
tggcttgatgagaaccaagcagctgacaaggaagattacgacgagaaattcaaggaagta
gaagctgtttgtaatccaatcatcactgccgtgtatcagagatctggtggagctcctggt
gctggatcacaagaagatgctgacgagctttag

KEGG   Papaver somniferum (opium poppy): 113329284Help
Entry
113329284         CDS       T05758                                 

Definition
(RefSeq) luminal-binding protein 5-like
  KO
K09490  heat shock 70kDa protein 5
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom03060  Protein export
psom04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    113329284
   04141 Protein processing in endoplasmic reticulum
    113329284
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:psom03110]
    113329284
   04131 Membrane trafficking [BR:psom04131]
    113329284
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psom04147]
    113329284
Chaperones and folding catalysts [BR:psom03110]
 Heat shock proteins
  HSP70 / DNAK
   113329284
Membrane trafficking [BR:psom04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    113329284
Exosome [BR:psom04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113329284
  Exosomal proteins of other body fluids (saliva and urine)
   113329284
  Exosomal proteins of colorectal cancer cells
   113329284
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl DDR Hydantoinase_A FtsA Radial_spoke_3 FGGY_C DctP
Motif
Other DBs
NCBI-GeneID: 113329284
NCBI-ProteinID: XP_026432027
Position
Unknown
AA seq 654 aa AA seqDB search
YSFPILFVFLFGIGIEIAKEEATAKFGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRI
TPSWVGFTSLGERLIGEAAKNQAPANPERTFFDSKRLIGRLFGDKDVQKDIKLLPYNVVN
KDGKPYVGVTLKDGEAKVFSPEEISAMVLTKMKETAETFLGKKVKDAVITVPAYFNDAQR
QATKDAGVIAGLNVVRIINEPTAAAIAYGLHKKGEEKNILVFDLGGGTFDVSILNIDNGV
FEVLSTNGDTHLGGEDFDHRVMDYFIKLIKKKHGKDISNDNKALGKLRRECERAKRALSN
QHSVRVEIESLYDGLDFSESLTRARFEELNTDLFKKTMGPVKKAMADAGLEKNQIDEIVL
VGGSTRIPKVQQLIKEYFNGKEPNKGVNPDEAVAYGAAVQGGILSGEGGDETKDVLLLDV
APLTLGIETVGGVMAKVIPRNTGIPTKRSQFFTTYQDQQTIVSIHVFEGERSLTKDCREL
GKFDLSGLAPATRGIPQIEVTFEVDANGILNVRAEDKASGKAEKITITTEKDRLSQEEID
RMVKEAEDFAEEDKKVKENIEARNSLESYVYNMKTQVNDNDKLADKLESDEKEKIEEAVK
EALEWLDENQAADKEDYDEKFKEVEAVCNPIITAVYQRSGGAPGAGSQEDADEL
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
tattcgtttcctattctatttgtatttctgtttggaataggaatagaaatagccaaagag
gaagcaacggcaaagttcggaacagtgattggtattgatcttggtacgacctattcatgt
gttggtgtttacaagaacggacatgtcgaaatcatagcaaacgaccaaggtaaccgtatt
acaccatcttgggttggttttacttctttaggagaacgtttgatcggtgaggctgcaaag
aatcaagcacctgcgaatcccgagagaactttcttcgatagcaaaagacttatcggaaga
ttgtttggcgataaagatgtacaaaaagatataaaactcttaccgtataacgtcgtgaat
aaagatggaaagccttatgttggggtaacgctcaaggatggggaagctaaagttttcagc
cctgaggaaatcagtgcgatggtactaactaagatgaaggagacagctgaaacgtttctt
ggaaagaaagttaaggatgccgttatcactgtaccagcttatttcaatgatgctcagaga
caggctacaaaggatgctggtgtgattgctggattgaatgtagtaagaatcatcaacgag
ccaactgcagctgcaatcgcctatggtttgcataaaaaaggtgaagagaagaacatcctt
gtttttgaccttggtggtggtacattcgacgtcagcatcttgaatattgataatggggtt
tttgaggttctttcgacaaacggtgacacgcatttgggaggtgaggactttgatcacagg
gttatggattacttcattaaattgatcaagaagaagcatggaaaggacattagcaacgac
aacaaggctcttgggaagctaaggagggagtgtgaacgtgctaagagagcgttgagtaac
caacattcggtgagagttgagattgagtctctatacgacggcttggatttctctgaatca
cttacccgtgctcgtttcgaagaattgaacactgatctattcaagaagaccatgggacct
gtgaagaaggctatggctgatgctggactagaaaaaaaccagattgatgagattgtcctt
gttggtggaagtactaggattcccaaggttcaacagctcattaaagaatacttcaacggc
aaagagccaaacaaaggtgtcaaccctgatgaggctgttgcttacggtgctgctgtacaa
ggaggtatcttgagcggagagggtggtgatgaaaccaaagatgttcttcttttggatgtc
gcaccacttactctcggtatcgaaaccgttggcggtgtgatggccaaggttatccctagg
aacacaggtatcccaaccaagcgatctcaattttttaccacttaccaggatcagcagacc
attgtctccatacatgttttcgaaggtgaaagaagtctcacaaaagactgcagggaactt
ggaaagtttgatctttctggacttgctccagctacaaggggaatccctcagattgaagtc
acattcgaggttgatgccaatggtattcttaatgtaagagctgaagacaaagcaagtgga
aaggcagagaagatcactatcacaactgaaaaggatcgcttgagccaagaggagattgac
cgaatggttaaagaagcggaggatttcgcagaggaagataagaaggtcaaggaaaatatc
gaggcgagaaacagcttggagagttatgtgtacaacatgaagacgcaggtcaatgataat
gacaagcttgcagacaagctggaatcagatgagaaagagaagattgaggaagcagtaaag
gaggctcttgaatggcttgatgagaaccaagcagctgacaaggaagattacgacgagaaa
ttcaaggaagtagaagctgtttgtaatccaatcatcactgccgtgtatcagagatctggt
ggagctcctggtgctggatcacaagaagatgctgacgagctttag

KEGG   Papaver somniferum (opium poppy): 113335417Help
Entry
113335417         CDS       T05758                                 

Definition
(RefSeq) luminal-binding protein 5-like
  KO
K09490  heat shock 70kDa protein 5
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom03060  Protein export
psom04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    113335417
   04141 Protein processing in endoplasmic reticulum
    113335417
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:psom03110]
    113335417
   04131 Membrane trafficking [BR:psom04131]
    113335417
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psom04147]
    113335417
Chaperones and folding catalysts [BR:psom03110]
 Heat shock proteins
  HSP70 / DNAK
   113335417
Membrane trafficking [BR:psom04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    113335417
Exosome [BR:psom04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113335417
  Exosomal proteins of other body fluids (saliva and urine)
   113335417
  Exosomal proteins of colorectal cancer cells
   113335417
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Radial_spoke_3 Hydantoinase_A FGGY_C
Motif
Other DBs
NCBI-GeneID: 113335417
NCBI-ProteinID: XP_026437258
Position
Unknown
AA seq 497 aa AA seqDB search
IGCCVLFSTAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYGLDKKTGEKNILVFD
LGGGTFDVSILTIDNGVFEVLSTNGDTHLGGEDFDHRVMDYFIKLIKKKHGKDISKDNRA
LGKLRRECERAKRALSNQHQVRVEIESLYDGLDFSEPLTRARFEELNNDLFKKTMGPVKK
AMADAGLEKKQIDEIVLVGGSTRIPKVQELLKEYFDGKEPSKGVNPDEAVAYGAAVQGGI
LSGEGGDETKDILLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTVS
IQVFEGERSLTKDCRELGKFDLSGLAPAPRGTPQIEVTFEVDANGILNVKAEDKASGKAE
KITITNEKGRLSQEEIDRMVKEAEDFAEEDKKVKEKIDARNSMESYVYNMKTQINDKDKL
ADKLESDEKEKIEAAVKEALEWLDENQSAEKEDYDEKLKEVEAVCNPIITAVYQRSGGAP
GAGSTDDAEDNEDHDEL
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
attggttgttgtgttctgttttctacagcatacttcaatgatgctcagagacaggctacc
aaggatgctggtgtgattgctggattaaatgtagcaagaatcatcaacgagcctaccgca
gcagctatcgcttatggtttggacaaaaagactggagagaagaacatccttgtttttgat
cttggtggtggtacattcgatgtcagtatcttgactattgataatggagtttttgaggtt
ctttccacaaacggagacactcatttgggaggtgaggactttgaccacagagttatggat
tacttcattaaattgatcaagaagaagcatggtaaggacatcagcaaggacaacagggct
cttggaaagcttaggagggaatgtgaacgtgctaagagagctttgagtaaccaacatcaa
gtccgtgttgagattgagtctctatacgacggtttggatttctctgaaccacttacccgt
gctcgtttcgaagaattgaacaatgatttattcaagaagaccatgggaccagtgaagaag
gctatggctgatgctggactagagaagaaacagattgatgagattgtacttgttggtgga
agtaccaggattcccaaggttcaagagctccttaaggaatactttgacggcaaagagccc
agcaaaggtgtcaacccagatgaggctgttgcttatggtgctgctgtacaaggaggtatc
ttgagtggagagggtggtgatgaaaccaaagatattcttctgttggatgttgccccactt
acactcggtattgaaactgttggaggtgtgatgaccaagttgatcccaagaaacacagtt
atcccaaccaagaagtctcaagtttttaccacttaccaggatcagcagaccactgtctct
attcaggttttcgaaggtgaaaggagtcttacaaaagactgcagggagcttggaaagttt
gatctttctggacttgctccagctccaaggggaacccctcagattgaagtcacttttgaa
gttgacgccaacggtattttgaacgtgaaggctgaggacaaggcaagtggaaaggcagag
aagatcactatcaccaatgagaagggtcgtttgagccaagaggagattgaccgtatggtt
aaagaggcagaggatttcgccgaggaagacaagaaggtcaaggaaaagattgatgccaga
aacagcatggagagttacgtctacaacatgaagacccagatcaatgacaaggacaagctt
gcagacaagctagagtctgatgagaaagagaagattgaggcagcagtaaaggaggccctt
gaatggcttgatgagaaccagtctgccgagaaggaagactatgatgagaaactcaaggaa
gtcgaagccgtttgcaacccaatcatcaccgctgtctaccaaagatctggtggagctcct
ggtgctggatcaaccgatgatgcagaagacaacgaagaccatgatgagctttag

KEGG   Papaver somniferum (opium poppy): 113345913Help
Entry
113345913         CDS       T05758                                 

Definition
(RefSeq) luminal-binding protein 5-like
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom03060  Protein export
psom04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    113345913
   04141 Protein processing in endoplasmic reticulum
    113345913
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FtsA
Motif
Other DBs
NCBI-GeneID: 113345913
NCBI-ProteinID: XP_026445343
Position
Unknown
AA seq 233 aa AA seqDB search
MAGMWSNRGFKSSLIVFSVLLSAYLCVICTAKEEATASKLGTVIGIDLGTTYSCVGVYKN
GHVEIIANDQGNRITPSWVAFTPGERLLGEAAKNQHAANPMGTVFDIKRLIGRKFDDKEV
QRDMKLLPYKIVNKEGKPYVEVKLKDTETKVFSPEEISAMILTKMKETAEAFLGKKVKDA
VITVPAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYGLDKKTGEKNIL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggccgggatgtggtcgaatcgcggattcaaatcttcactaatcgtattctcagtcctc
ctttccgcttatttatgtgtaatctgtactgcgaaagaggaagcaacagcatcaaaatta
ggaacagtaattggtatcgatcttggtacaacttattcctgtgttggtgtttacaaaaac
ggacatgttgaaatcatagctaatgaccaaggtaaccgtattactccttcatgggttgcg
tttactcctggtgaacgtttgttgggtgaggctgcaaagaatcaacacgcagctaatccc
atgggaactgtctttgatatcaaaagacttatcggaagaaagtttgatgataaagaggta
cagagagatatgaaactcttaccttacaagattgtcaacaaggaaggaaagccttatgtg
gaggttaaactaaaggatactgagactaaggttttcagccctgaggaaattagtgctatg
attcttaccaagatgaaggaaacagctgaagcattcttaggaaagaaggttaaggatgcc
gtcattactgttcctgcatacttcaatgatgctcagagacaggctaccaaggatgctggt
gtgattgctggattaaatgtagcaagaatcatcaacgagcctaccgcagcagctatcgct
tatggtttggacaaaaagactggagagaagaacatcctt

KEGG   Papaver somniferum (opium poppy): 113346498Help
Entry
113346498         CDS       T05758                                 

Definition
(RefSeq) luminal-binding protein 5-like
  KO
K09490  heat shock 70kDa protein 5
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom03060  Protein export
psom04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    113346498
   04141 Protein processing in endoplasmic reticulum
    113346498
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:psom03110]
    113346498
   04131 Membrane trafficking [BR:psom04131]
    113346498
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psom04147]
    113346498
Chaperones and folding catalysts [BR:psom03110]
 Heat shock proteins
  HSP70 / DNAK
   113346498
Membrane trafficking [BR:psom04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    113346498
Exosome [BR:psom04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113346498
  Exosomal proteins of other body fluids (saliva and urine)
   113346498
  Exosomal proteins of colorectal cancer cells
   113346498
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FtsA DDR Radial_spoke_3 Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 113346498
NCBI-ProteinID: XP_026445832
Position
Unknown
AA seq 669 aa AA seqDB search
MEGSWRNHGCSSSLMVFLILLCSSLCVFSIAKEEATKLGTVIGIDLGTTYSCVGVYKDGH
VQIIANDQGNRITPSWVGFTPKERLIGEAAKNQAASNPENTVYDMKRLIGRLFADKNLQK
DMKLFPYKIVNKEGKPYVRVTINDGETKDFSPEELSAMVLTKMKETAEAFLGKKVKDAVV
TVPAYFNDAQRQATKDAGVIAGLNVVRIINEPTAAAIAYGLDKKGEEKNILVFDLGGGTF
DVSILNIDNGVFEVLSTNGDTHLGGEDFDHRVMDHFIKLIKKKHGKDISKDKKALGKLRR
ECERAKRALSNQHQVRVEIESLFDGLDFSEPLSRARFEELNADLFKKTMGPVKKAMADAG
LEKHQIDEIVLVGGSTRIPKVQELLKEYFDGKEPSKGINPDEAVAYGAAVQGGILSGEGG
AETKDVLLLDVAPLTLGIETVGGVMTKVIPRNTGIPTTRSQVFSTYQDQQTTVSVRVFEG
ERSLTKDCRELGKFDLTGIAPAPRGIPQIQVTFEVDANGILSVRAEDKASGKAEKITITA
NKDRLSQEEINRMVQEAEDFAEEDKKVKEKIEARNKLESYVYNMKTQVNDKDKLADKLES
DEKEKIEEAVKEALEWLDENHEADKEDYDEKFKEVEAVCNPIITAMYQRSGGAPGAGSPE
DDDDSHDEL
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atggaggggtcgtggagaaatcatggatgctcatcttcattaatggtattcttaatcctc
ttatgcagttctttatgtgtattttccattgcgaaagaggaagcaacaaagttaggaaca
gtgattggtattgatcttggtacaacatattcatgtgttggtgtttacaaggatggacat
gttcaaatcatagcaaacgaccaaggtaaccgtattaccccatcatgggttgggtttact
cctaaagaacgtttgatcggtgaggctgcgaagaatcaagctgcttctaatcctgaaaat
acagtctacgatatgaaacgacttatcggaagattgtttgctgataaaaatttacagaag
gatatgaagctcttcccatataagattgtgaataaagaaggaaagccttatgttcgtgtc
acgatcaatgatggggagactaaagatttcagtcctgaggaacttagtgctatggtttta
actaagatgaaggagaccgctgaagcattcctcggaaagaaagttaaggatgccgttgtc
actgtacctgcatacttcaatgatgctcagagacaggctaccaaggatgctggcgtgatt
gctggtttgaatgtcgtgagaatcatcaatgagccgacagcagctgctatcgcctatggc
ttggacaaaaaaggagaagagaaaaacattcttgtttttgaccttggtggtggtacattt
gatgtcagtatcttgaatattgataatggagtttttgaggttctttccacaaacggagac
actcacctgggaggtgaagactttgatcacagagttatggatcacttcattaaattgatc
aagaagaagcatggaaaggacatcagcaaggacaaaaaggctcttgggaagctgaggagg
gagtgtgaacgtgctaagagagccttgagtaaccaacatcaagtgcgagttgagattgag
tctctattcgacggcttggatttctcagaaccactgtcccgtgctcgtttcgaagaattg
aacgctgatctattcaagaagaccatgggacctgtgaagaaggctatggctgatgctgga
ctagagaaacaccagatagatgagattgtccttgttggtggaagtactaggattcccaag
gttcaagagctccttaaagaatacttcgatggaaaagagccaagcaaaggtatcaaccca
gatgaggctgttgcttatggtgctgctgtacaaggaggtatcttgagtggagagggtggt
gctgaaaccaaagatgtccttctattggatgtcgccccacttactctcggtattgaaact
gttggtggtgtgatgaccaaggtgatccctaggaacacaggcatcccaaccacgcgatct
caagtttttagcacttaccaggatcagcagaccactgtctctgttcgtgttttcgaaggt
gaaagaagtctcacaaaagactgcagggagcttggaaagtttgatcttactggaattgct
ccagctccaaggggaatccctcagattcaagtcacattcgaggttgatgccaatggtatt
ttgagtgtaagggctgaagacaaggcaagtggaaaggcagagaagatcactatcacagct
aacaaggatcgtttgagccaagaggagattaaccgaatggttcaagaggcagaggatttc
gccgaggaagataagaaggtcaaggaaaagattgaggcaaggaacaaattggagagttat
gtgtacaacatgaagacccaggtcaatgataaggacaagcttgcagacaagctggaatca
gatgagaaagagaagattgaggaagcagtaaaggaggctcttgagtggcttgatgagaac
cacgaagccgacaaggaagactacgacgagaaattcaaggaagtagaagctgtttgcaat
ccaatcatcactgccatgtatcagagatctggtggagctcctggtgctggatcaccagaa
gatgatgatgattcacacgatgagctttag

KEGG   Papaver somniferum (opium poppy): 113356431Help
Entry
113356431         CDS       T05758                                 

Definition
(RefSeq) luminal-binding protein 5-like
  KO
K09490  heat shock 70kDa protein 5
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom03060  Protein export
psom04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    113356431
   04141 Protein processing in endoplasmic reticulum
    113356431
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:psom03110]
    113356431
   04131 Membrane trafficking [BR:psom04131]
    113356431
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psom04147]
    113356431
Chaperones and folding catalysts [BR:psom03110]
 Heat shock proteins
  HSP70 / DNAK
   113356431
Membrane trafficking [BR:psom04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    113356431
Exosome [BR:psom04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113356431
  Exosomal proteins of other body fluids (saliva and urine)
   113356431
  Exosomal proteins of colorectal cancer cells
   113356431
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FtsA DDR Radial_spoke_3 Hydantoinase_A DctP Stathmin
Motif
Other DBs
NCBI-GeneID: 113356431
NCBI-ProteinID: XP_026455345
Position
3
AA seq 669 aa AA seqDB search
MDGSWRNRGFSSSLTVFLILLCSSLCVYSIAKEESTKLGTVIGIDLGTTYSCVGVYKDGH
VQIIANDQGNRITPSWVGFTPKERLIGEAAKNQAASNPENTVYDMKRLIGRLFADKNLQK
DMKLFPYKIVNKEGKPYVRVTINDGETKDFSPEELSAMVLTKMKETAEAFLGKKVKDAVV
TVPAYFNDAQRQATKDAGVIAGLNVVRIINEPTAAAIAYGLDKKGEEKNILVFDLGGGTF
DVSILNIDNGVFEVLSTNGDTHLGGEDFDHRVMDHFIKLIKKKHGKDISKDNKALGKLRR
ECERAKRALSNQHQVRVEIESLFDSVDFSEPLSRARFEELNADLFKKTMGPVKKAMADAG
LEKHQIDEIVLVGGSTRIPKVQELLKEYFDGKEPSKGINPDEAVAYGAAVQGGILSGEGG
DETKDVLLLDVAPLTLGIETVGGVMTKVIPRNTGIPTTRSQVFSTYQDQQTTVSIRVFEG
ERSLTKDCRELGKFDLTGIAPAPRGVPQIQVTFEVDANGILSVRAEDKASGKAEKITITA
NKDRLSQEEIDRMVQEAEDFAEEDKKVKEKIEARNKLESYVYNMKTQVNDKDKLADKLDS
DDKEKIEEAVKEALEWLDENQEADKEDYDEKFKEVEAVLNPIITSMYQKSGGATGAGSPE
DDDDSHDEL
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atggacgggtcgtggagaaatcgtggattctcatcttcattaacggtattcttaatcctc
ttatgcagttctttatgtgtatattccatagcgaaagaggaatcaacaaagttaggaaca
gtaattggtatcgatcttggtacgacatattcatgtgtgggtgtttacaaggatggacat
gttcaaatcatagcaaacgaccaaggtaaccgtattaccccttcatgggttgggtttact
cctaaagaacgtttgatcggtgaggctgcaaagaatcaagctgcttctaatcctgaaaat
acagtctacgatatgaaaagacttatcggaagattgtttgctgataaaaatttacagaag
gatatgaagctcttcccatataagattgtgaataaagaaggaaagccttatgttcgtgtc
acgatcaacgatggggagactaaagatttcagtcctgaggaacttagtgctatggtttta
actaagatgaaggagacagctgaagcgttcctcggaaagaaagttaaggatgccgttgtc
actgtacctgcatacttcaatgatgctcagagacaggctacaaaggatgctggcgtgatt
gctggtttaaatgtcgtgaggatcatcaacgagccgacagcagctgctatcgcctatggt
ttggacaaaaaaggtgaagagaagaacattcttgtttttgaccttggtggtggtactttt
gatgtcagtatcttgaatattgacaatggagttttcgaggttctttccacaaacggagac
actcacctgggaggtgaagactttgatcacagagttatggatcacttcattaaattgatc
aagaagaagcatgggaaggacatcagcaaggacaacaaggctcttgggaagctgaggagg
gagtgtgaacgtgctaagagagccttgagtaaccaacatcaagtgcgagttgagattgag
tcactattcgacagcgtggatttctcagaaccactgtcccgtgctcgtttcgaagaattg
aacgctgatctattcaagaagaccatgggacctgtgaagaaggctatggctgatgctgga
ctagagaaacaccagatagatgagattgtccttgttggtggaagtactaggattcccaag
gttcaagagctccttaaagaatactttgatggaaaagagccaagcaaaggtatcaaccca
gatgaggctgttgcttacggtgctgctgtacaaggaggtatcttgagtggagagggtggt
gatgaaaccaaagatgttcttctattggatgtcgccccacttactctcggtattgaaact
gttggtggtgtgatgaccaaggtgatccctaggaacacaggcatcccaaccacgcgatct
caagtttttagcacttaccaggatcagcagaccactgtctctattcgtgttttcgaaggt
gaaagaagtctcacaaaagactgcagggagcttggaaagtttgatcttactggaattgct
ccagctccaaggggagtccctcagattcaagtcacattcgaggttgatgccaatggtatt
ttgagtgtaagggctgaagacaaggcaagtggaaaggcagagaagatcactatcacagct
aacaaagatcgtttgagccaagaggagattgaccgaatggttcaagaggcagaggatttc
gcagaggaagataagaaggtcaaggaaaagatcgaggcaagaaacaagttggagagttat
gtgtacaacatgaagacccaggtcaatgataaggacaagcttgcagacaagctggactca
gatgacaaagagaagattgaggaggcagtaaaggaggctcttgaatggcttgatgagaac
caagaagctgacaaggaagactatgacgagaaattcaaggaagtagaagctgttttaaat
ccaatcatcacttccatgtatcagaaatctggtggagctactggtgctggatcaccagaa
gatgatgatgattcacacgatgagctttag

KEGG   Papaver somniferum (opium poppy): 113358498Help
Entry
113358498         CDS       T05758                                 

Definition
(RefSeq) luminal-binding protein
  KO
K09490  heat shock 70kDa protein 5
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom03060  Protein export
psom04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    113358498
   04141 Protein processing in endoplasmic reticulum
    113358498
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:psom03110]
    113358498
   04131 Membrane trafficking [BR:psom04131]
    113358498
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psom04147]
    113358498
Chaperones and folding catalysts [BR:psom03110]
 Heat shock proteins
  HSP70 / DNAK
   113358498
Membrane trafficking [BR:psom04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    113358498
Exosome [BR:psom04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113358498
  Exosomal proteins of other body fluids (saliva and urine)
   113358498
  Exosomal proteins of colorectal cancer cells
   113358498
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Hydantoinase_A FtsA DDR Radial_spoke_3 FGGY_C
Motif
Other DBs
NCBI-GeneID: 113358498
NCBI-ProteinID: XP_026457876
Position
3
AA seq 668 aa AA seqDB search
MGGSWRSRSSLILLAIVLCGCLSAFTIAKEEASKLGTVIGIDLGTTYSCVGVYKNGHVEI
IANDQGNRITPSWVSFNDDERLIGEAAKNLAAVNPERTIFDVKRLIGRKFDDKEVQKDMK
LVPYKIVNKDGKPYIQVKVKDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVP
AYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVS
ILTIDNGVFEVLATNGDTHLGGEDFDHRIMDYFIKLIKKKHSKDISKDNRALGKLRRECE
RAKRALSNQHQVRVEIESLYDGLDFSEPLTRARFEELNNDLFRKTMGPVKKAMDDAGLQK
NQIDEIVLVGGSTRIPKVQQLLKDFFDGKEPNKGVNPDEAVAYGAAVQGSILSGEGGEET
KDILLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTVSIKVYEGERS
LTKDCRELGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKAEDKGTGRAEKITITNDKG
RLSQEEIERMVKEAEEFAEEDKKVKEKIDARNGLETYIYNMKNQIGDKDKLAEKLESEEK
EKIEAAVKEALEWLDENQSAEKEDYDEKLKEVEAVCNPIITAVYQRSGGPSGGAASEDAE
DDDSHDEL
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgggtggctcttggaggagtcgcagttctttgattttattagcaatcgtattatgtgga
tgcttgtctgcatttaccattgctaaagaggaagcatccaagttgggaactgttattgga
atagatcttggtacaacttattcctgtgttggtgtttacaaaaatggccatgttgaaatt
atagcaaatgatcaaggaaacaggattactccatcatgggtttcattcaacgatgacgag
agacttattggtgaggctgcaaagaatcttgcagctgttaatcccgagaggaccatcttt
gatgtcaaaaggcttatcggaagaaagtttgatgacaaagaggtgcaaaaggacatgaaa
cttgttccatataaaattgtgaacaaggatggaaagccttacatccaggttaaggttaag
gatggagagacaaaggtcttcagtcccgaggagattagtgctatgattctaactaagatg
aaagaaaccgccgaagcattccttgggaagaaaattaaggatgctgttgttaccgtccct
gcatactttaatgatgcccagaggcaagcaactaaagatgccggcgttatcgctggactt
aatgttgctagaattatcaatgaaccaaccgctgccgctatcgcctatggtttggacaag
aagggtggcgagaagaacatccttgtctttgatcttggtggtggaacttttgatgtcagt
atcttgacaattgacaatggagtatttgaggttttggccacaaatggagacactcatttg
ggaggagaggactttgaccacagaataatggattacttcatcaaattgatcaagaagaag
cacagcaaggacatcagcaaggacaacagggctcttggaaaattgagaagggagtgtgaa
cgtgccaagagagctttgagtaaccagcaccaggtccgagttgagattgagtccctatac
gatggcttagatttctctgaaccacttacccgagctagatttgaggagttgaacaatgat
ctattcagaaagaccatgggacctgtaaagaaggcaatggacgatgctggcttacagaaa
aaccagatcgacgagattgttcttgttggtggtagtacgagaattcccaaggttcaacaa
ctcctaaaagatttctttgacggtaaagaacccaacaagggagttaacccagatgaagct
gttgcttatggtgctgctgtacaaggaagtatcttgagtggagaaggtggtgaagaaacc
aaagacattcttctgttggatgttgcacccctcacccttggtattgaaactgtcggtgga
gttatgaccaagttgattccaaggaacacagttatccctaccaagaaatctcaagttttc
accacttaccaggatcaacaaactactgtctctatcaaggtttatgaaggtgaaaggagt
ctcacaaaggactgtagggagcttggaaaatttgaccttactggaattcctccagctcca
aggggaacccctcaaattgaagtaacatttgaggttgacgctaatggtatcctaaacgtt
aaggctgaagacaaggggactgggcgtgcagagaagatcaccatcacaaatgacaaaggt
cgtttgagccaggaggaaattgaacgtatggttaaggaagcagaggagtttgccgaagaa
gacaagaaggtcaaagagaagattgatgcgcgtaacggtttagaaacctacatttacaac
atgaagaaccaaatcggtgacaaggacaaacttgcagaaaagttggaatctgaagagaaa
gagaagattgaagctgctgtgaaggaagcacttgaatggctcgacgagaaccagagtgct
gaaaaggaggattatgatgagaagctcaaggaggtcgaggctgtctgtaaccctatcatc
accgctgtttaccaaagatctggtggaccttctggtggagctgcatcagaagatgcagaa
gatgatgattcacacgatgagctttga

DBGET integrated database retrieval system