KEGG   Papaver somniferum (opium poppy): 113323637Help
Entry
113323637         CDS       T05758                                 

Definition
(RefSeq) nitrilase-like protein 2
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
psom  Papaver somniferum (opium poppy)
Brite
KEGG Orthology (KO) [BR:psom00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    113323637
Enzymes [BR:psom01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     113323637
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 113323637
NCBI-ProteinID: XP_026427755
Position
11
AA seq 286 aa AA seqDB search
MANNSNHTVRIAAAQMTSINDLTSNFNTCSHLVKEAVAAGAKMICFPENFSFVGARDGES
MKIAEPLDGPIMQKYCSLARESNIWLSLGGFQEKGPDDTHLCNAHVLIDDTGHLRSTYRK
IHLFDVDIPGGAVFKESSFTEAGKNIVVVDSPVGRLGLTVCYDLRFPELYQRLRYQHQAQ
VLLVPAAFTKITGEAHWEILLRARAIETQCYVIAAAQAGKHNDKRESYGDTLIIDPWGKV
VGRLPDRASTGIVIADIDFSLIDSVRTKMPISEHMKPLKFWNSASP
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacaacagcaaccacacagtgagaatagctgctgcacagatgacatcaatcaat
gacctaacttccaatttcaatacttgttctcatcttgtaaaggaggctgttgctgctgga
gcaaaaatgatttgttttccagaaaacttttcttttgttggtgccagagatggagaaagt
atgaaaattgcggaacctctagatgggccaatcatgcaaaaatattgttccctcgctaga
gaatccaacatatggttgtcactgggaggatttcaagagaaaggacctgatgatacacac
ttgtgtaatgcacatgttttaattgatgatactgggcatcttaggagcacataccggaaa
atacacttgtttgatgtggatattcctggcggagctgtcttcaaggagagtagttttact
gaagcagggaagaatattgtcgtagtagatagccctgttgggcgtttgggtctaactgtc
tgctatgatttgaggttcccggagctttaccagcggttacgttatcagcatcaagcacag
gttctcttagtacctgcagcttttactaagataactggggaggctcattgggagattctc
cttcgtgctcgtgcaattgaaacccagtgctatgtaattgctgctgcacaagctggaaag
cacaatgataaaagagaaagctatggtgacaccttaattatcgacccatggggaaaagtt
gtcggtcgactaccagatcgagcttcaactggtattgttatagcagatattgacttctca
ttaatagattctgttagaactaaaatgcctatttcagagcatatgaagccacttaaattc
tggaactctgcttctccctga

DBGET integrated database retrieval system