KEGG   Papaver somniferum (opium poppy): 113324337Help
Entry
113324337         CDS       T05758                                 

Definition
(RefSeq) probable glycosyltransferase At5g20260
  KO
K18789  xylogalacturonan beta-1,3-xylosyltransferase [EC:2.4.2.41]
Organism
psom  Papaver somniferum (opium poppy)
Brite
KEGG Orthology (KO) [BR:psom00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:psom01003]
    113324337
Enzymes [BR:psom01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.41  xylogalacturonan beta-1,3-xylosyltransferase
     113324337
Glycosyltransferases [BR:psom01003]
 Polysaccharide
  Structural polysaccharide
   113324337
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exostosin Glycos_transf_1
Motif
Other DBs
NCBI-GeneID: 113324337
NCBI-ProteinID: XP_026428438
Position
11
AA seq 450 aa AA seqDB search
MAAAASLKKLFLLFALFSTVFISQSSQTHGYSNGFISTSSYPTTISSKSTNHEQNELNRI
EEGLKRARYAIRRAARKRNLTNSDSKEKDEFVSRGSIYINPYAFHQSYIEMEKRLKVWTY
KEGQQPLFHDGPLGYVYSTEGHFIDEMESGLSPFTTQNPDEAHLFFLPFSVVNIKRFILA
PNPSIPWTWLQLFVEDYIKVVSDKYPFWNRSSGADHFMVSCHDRGTQISSAFPRELFKNL
IRVLCNANTSEGFHPIRDATLPEVNLKHGELGHPQLGNQPTTNRPILAFFAGRAHGYGRS
VLFSYWKDKDDEVRVYESLPKPLNYTNLMTQSKFCLCPSGYEVASPRIVEAIYVGCVPVI
LSDHYVLPFSDVLNWSQFSIQIPVQRIPEIKVILKNISAVEYLKMQSRVLQVKRHFILNR
PAQRFDLLHMVLHPVWLRSLNIGFTSEVGG
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgctgcatccttaaagaaactcttccttttgtttgctctcttctcaacagtt
ttcatctctcaatcttcccaaacccatggttactctaacgggttcatatcaacctcctcc
tatccaaccaccattagcagcaaatcaactaatcatgaacaaaatgagctaaacaggata
gaagaaggcctaaaaagagctcgatacgcgattcgccgagcagctcgtaaacggaatctt
actaattccgatagcaaagagaaggatgaattcgtctcaagaggttctatttacattaat
ccatatgcatttcatcagagttatatcgagatggagaagagattgaaagtgtggacgtac
aaagaaggccaacagccactattccatgatggtccattaggctacgtttactcaacagag
ggacattttatagatgagatggaaagtggattgagtccgtttacaactcaaaatcctgat
gaggctcatttgttcttccttccgttcagcgtggttaacatcaagagattcattctcgca
ccaaatccatcgatcccgtggacatggcttcaactgtttgtggaagattatataaaggtt
gtctcggacaaatatccgttttggaatagaagcagcggagctgaccattttatggtttca
tgccatgatcgagggacacaaatttctagtgcttttccgcgcgagttgttcaagaatttg
atcagggttctttgtaatgccaacacctcagaaggtttccatcccatcagagatgcaaca
cttcctgaagtgaacctaaaacatggagaacttggtcatccgcaactcggcaatcaacct
actacgaatcgtcccatccttgctttctttgctggccgagcacatggttatgggagaagt
gtgttattcagttattggaaagataaagatgatgaggtccgagtctatgagagcttgccg
aaaccgctgaactacactaatttgatgacccagagtaagttttgtctgtgcccaagtgga
tatgaagttgcaagtcctaggattgttgaagcaatatatgttgggtgtgttccggtcata
ctttctgatcattatgtactcccgtttagcgatgtactcaactggagccagttttcaatt
caaattccggttcaaagaatacctgagattaaggttatcctgaaaaacatttcagccgtg
gagtacctaaaaatgcaaagtagagtactgcaagtgaagagacattttatcctcaatagg
cctgctcagagatttgatttacttcatatggtactccacccggtgtggttaaggagcctt
aatatagggttcacttctgaagttggtggttaa

DBGET integrated database retrieval system