KEGG   Papaver somniferum (opium poppy): 113324587Help
Entry
113324587         CDS       T05758                                 

Definition
(RefSeq) probable mediator of RNA polymerase II transcription subunit 37c
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom03040  Spliceosome
psom04141  Protein processing in endoplasmic reticulum
psom04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    113324587
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113324587
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113324587
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:psom01009]
    113324587
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:psom03041]
    113324587
   03009 Ribosome biogenesis [BR:psom03009]
    113324587
   03110 Chaperones and folding catalysts [BR:psom03110]
    113324587
   04131 Membrane trafficking [BR:psom04131]
    113324587
   03051 Proteasome [BR:psom03051]
    113324587
   03029 Mitochondrial biogenesis [BR:psom03029]
    113324587
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psom04147]
    113324587
Protein phosphatases and associated proteins [BR:psom01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     113324587
Spliceosome [BR:psom03041]
 Complex B
  Other components
   Prp19 complex
    113324587
 Complex C
   Prp19-CDC5 complex
    113324587
Ribosome biogenesis [BR:psom03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    113324587
Chaperones and folding catalysts [BR:psom03110]
 Heat shock proteins
  HSP70 / DNAK
   113324587
Membrane trafficking [BR:psom04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    113324587
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    113324587
Proteasome [BR:psom03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    113324587
Mitochondrial biogenesis [BR:psom03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    113324587
Exosome [BR:psom04147]
 Exosomal proteins
  Proteins found in most exosomes
   113324587
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70
Motif
Other DBs
NCBI-GeneID: 113324587
NCBI-ProteinID: XP_026428682
Position
11
AA seq 249 aa AA seqDB search
MDRNSVHDVVLVGGSTRIPEVQQLLQEFFDGKKFCNSINPDEAVAYGAAMQAAILSGETN
QNLDQLLLLDVTPLSLGLETAGGVLTTSIAPNTSIPTEEEQVFSTYSNNQPRISIRTMSQ
SLMIKKTCPGRRLRRWCKKPRSTRLKMNNTSRKFESKNALENMRNTTKDEKFAGKLTPAD
KKKNEAAIQWLDTQLLLGCIKVVLVLTWVVSVAWMRMILKWEVLVVVQDLRLRKLIKWNL
VEGYDCLGS
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggacaggaacagtgttcatgatgttgttctggtcggtggatcaactaggattcctgaa
gtgcagcaattgttgcaggagttctttgatgggaaaaaattctgcaacagtattaacccc
gatgaagctgtggcttatggagcggctatgcaggctgcgattttgagtggtgaaactaat
cagaacttggatcaattgttgctgttggacgttactcctctctcccttgggctcgagaca
gctggaggggtactgactacatcaattgcaccaaacaccagtattcccaccgaagaggag
caagttttctccacctactccaacaaccagcctagaatatcaatcagaacaatgtcacaa
tcactaatgataaagaaaacttgtccagggaggagattgagaagatggtgcaagaagccg
agaagtacaagactgaagatgaacaacacgagcagaaagtttgagtcgaagaatgctttg
gagaatatgaggaataccaccaaggatgaaaagtttgctgggaagttaacaccagctgac
aagaagaaaaatgaagctgctattcagtggcttgatacccaattgttgctgggatgtatc
aaggtggtgctggtcctgacatgggtggtttcggtggcatggatgaggatgatccttaaa
tgggaggtgctggtagtagtgcaggacctaagattgaggaagttaatcaagtggaacttg
gtggagggatatgactgcttggggtcctaa

DBGET integrated database retrieval system